FC876736
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC876736 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSJ (Hydrophobic protein LTI6B OS=Oryza sativa subsp. japonica GN=LTI6B PE=2 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 9.112e-13 Identity = 32/40 (80.00%), Postives = 35/40 (87.50%), Query Frame = 2 Query: 149 VPPLGVFRKLGCEADFWICLLLTILGYIPGIIYAVYAITK 268 +PPLGVF K GC +FWICLLLT LGYIPGIIYA+YAITK Sbjct: 16 LPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55
BLAST of FC876736 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSI (Hydrophobic protein LTI6B OS=Oryza sativa subsp. indica GN=LTI6B PE=3 SV=2) HSP 1 Score: 73.559 bits (179), Expect = 9.112e-13 Identity = 32/40 (80.00%), Postives = 35/40 (87.50%), Query Frame = 2 Query: 149 VPPLGVFRKLGCEADFWICLLLTILGYIPGIIYAVYAITK 268 +PPLGVF K GC +FWICLLLT LGYIPGIIYA+YAITK Sbjct: 16 LPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55
BLAST of FC876736 vs. ExPASy Swiss-Prot
Match: RCI2A_ARATH (Hydrophobic protein RCI2A OS=Arabidopsis thaliana GN=RCI2A PE=2 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 7.713e-12 Identity = 28/40 (70.00%), Postives = 35/40 (87.50%), Query Frame = 2 Query: 149 VPPLGVFRKLGCEADFWICLLLTILGYIPGIIYAVYAITK 268 +PPLGVF + GC +FWICL+LT+LGYIPGIIYA+Y +TK Sbjct: 15 LPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54
BLAST of FC876736 vs. ExPASy Swiss-Prot
Match: RCI2B_ARATH (Hydrophobic protein RCI2B OS=Arabidopsis thaliana GN=RCI2B PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.316e-11 Identity = 27/40 (67.50%), Postives = 35/40 (87.50%), Query Frame = 2 Query: 149 VPPLGVFRKLGCEADFWICLLLTILGYIPGIIYAVYAITK 268 +PPLGVF K GC+ +FWICL+LT+ GY+PGI+YA+Y ITK Sbjct: 15 LPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54
BLAST of FC876736 vs. ExPASy Swiss-Prot
Match: LTI6A_ORYSJ (Hydrophobic protein LTI6A OS=Oryza sativa subsp. japonica GN=LTI6A PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.828e-11 Identity = 29/40 (72.50%), Postives = 33/40 (82.50%), Query Frame = 2 Query: 149 VPPLGVFRKLGCEADFWICLLLTILGYIPGIIYAVYAITK 268 +PPLGVF K GC +FWICLLLT GY+PGIIYAV+ ITK Sbjct: 17 LPPLGVFFKFGCGIEFWICLLLTFFGYLPGIIYAVWVITK 56 The following BLAST results are available for this feature:
BLAST of FC876736 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 5
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FC876736 ID=FC876736; Name=FC876736; organism=Citrus clementina; type=EST; length=610bpback to top |