FC925149
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC925149 vs. ExPASy Swiss-Prot
Match: NEP2_NEPGR (Aspartic proteinase nepenthesin-2 OS=Nepenthes gracilis GN=nep2 PE=1 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 2.554e-14 Identity = 34/67 (50.75%), Postives = 44/67 (65.67%), Query Frame = 2 Query: 314 LESGVSLGAGEYFMDVFVGTPPKHYYFILDTGSDLNWIQCVPCYDCFDQNGPHYDPKDSSSFKNITC 514 +E+ V G GEY M+V +GTP + I+DTGSDL W QC PC CF Q P ++P+DSSSF + C Sbjct: 85 IETPVYAGDGEYLMNVAIGTPDSSFSAIMDTGSDLIWTQCEPCTQCFSQPTPIFNPQDSSSFSTLPC 151
BLAST of FC925149 vs. ExPASy Swiss-Prot
Match: NEP1_NEPGR (Aspartic proteinase nepenthesin-1 OS=Nepenthes gracilis GN=nep1 PE=1 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 4.357e-14 Identity = 36/81 (44.44%), Postives = 52/81 (64.20%), Query Frame = 2 Query: 272 ESYASGVSGQLVATLESGVSLGAGEYFMDVFVGTPPKHYYFILDTGSDLNWIQCVPCYDCFDQNGPHYDPKDSSSFKNITC 514 E+ +G SG +E+ V G GEY M++ +GTP + + I+DTGSDL W QC PC CF+Q+ P ++P+ SSSF + C Sbjct: 75 EAMLNGPSG-----VETSVYAGDGEYLMNLSIGTPAQPFSAIMDTGSDLIWTQCQPCTQCFNQSTPIFNPQGSSSFSTLPC 150 The following BLAST results are available for this feature:
BLAST of FC925149 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FC925149 ID=FC925149; Name=FC925149; organism=Citrus clementina; type=EST; length=519bpback to top |