FC928899

Overview
NameFC928899
Unique NameFC928899
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length785
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15013 contig Ccv1_Contig15013:1..785. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928899 vs. ExPASy Swiss-Prot
Match: MYG1_HUMAN (UPF0160 protein MYG1, mitochondrial OS=Homo sapiens GN=C12orf10 PE=1 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.558e-43
Identity = 103/266 (38.72%), Postives = 142/266 (53.38%), Query Frame = 3
Query:  147 RVGTHNGSFHCDEALGCFMIRLTDKFFNAQIVRSR------------------DPK------------------------------------HFGKELIAKELNVDEGHPDVHRLFLAVYKNFMEAIDAIDNGINQYDTDKPPRYVNNTNLSSRVGKLNLDWTEPDQSAERENEAFQQGMDLAGKEFLDTVRFYVRSWLPARSIVVECIAERYDYDPSGEIMVL-KRFCPWKLHLFELEEEMKIEPLIKYVLYEDDRGKQWRVQAV 779
            R+GTHNG+FHCDEAL C ++RL  ++ +A+IVR+R                  DP+                                    HFG +L+A+ L   E    V  L+  +Y+NF+E +DA+DNGI+Q+  +  PRY   T LS+RV +LN  W  PDQ  E     F++ MDL  +EFL  + FY  SWLPAR++V E +A+R+  DPSGEI+ L K  CPWK HL+ LE  +     I +V+Y D  G QWR+Q V
Sbjct:   46 RIGTHNGTFHCDEALACALLRLLPEYRDAEIVRTRDPEKLASCDIVVDVGGEYDPRRHRYDHHQRSFTETMSSLSPGKPWQTKLSSAGLIYLHFGHKLLAQLLGPSEEDSMVGTLYDKMYENFVEEVDAVDNGISQW-AEGEPRYALTTTLSARVARLNPTWNHPDQDTEA---GFKRAMDLVQEEFLQRLDFYQHSWLPARALVEEALAQRFQVDPSGEIVELAKGACPWKEHLYHLESGLSPPVAIFFVIYTDQAG-QWRIQCV 306          
BLAST of FC928899 vs. ExPASy Swiss-Prot
Match: MYG1_BOVIN (UPF0160 protein MYG1, mitochondrial OS=Bos taurus PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 2.034e-43
Identity = 103/266 (38.72%), Postives = 145/266 (54.51%), Query Frame = 3
Query:  147 RVGTHNGSFHCDEALGCFMIRLTDKFFNAQIVRSR------------------DPK------------------------------------HFGKELIAKELNVDEGHPDVHRLFLAVYKNFMEAIDAIDNGINQYDTDKPPRYVNNTNLSSRVGKLNLDWTEPDQSAERENEAFQQGMDLAGKEFLDTVRFYVRSWLPARSIVVECIAERYDYDPSGEIMVL-KRFCPWKLHLFELEEEMKIEPLIKYVLYEDDRGKQWRVQAV 779
            R+GTHNG+FHCDEAL C ++RL  ++  A+IVR+R                  DP+                                    HFG +L+A+ L   E    V  L+  +Y+NF+E +DA+DNGI+Q++  +P RY+  T LS+RV +LN  W +P+Q  E     F++ MDL  +EFL  + FY  SWLPAR++V E +A+R+  DPSGEI+ L K  CPWK HL++LE  +     I +V+Y D  G QWRVQ V
Sbjct:   46 RIGTHNGTFHCDEALACALLRLLPEYREAEIVRTRDPEKLAACDIVVDVGGEYDPQRHRYDHHQRSFTETMSSLSPGKPWQTKLSSAGLIYLHFGHKLLAQLLGTSEEDGMVGTLYDKMYENFVEEVDAVDNGISQWEEGEP-RYLLTTTLSARVARLNPTWNQPNQDTEA---GFKRAMDLVREEFLQRLDFYQNSWLPARTLVEEALAKRFQVDPSGEIIELEKGGCPWKEHLYQLELGLSPAGTIAFVIYTDQAG-QWRVQCV 306          
BLAST of FC928899 vs. ExPASy Swiss-Prot
Match: U160_DICDI (UPF0160 protein OS=Dictyostelium discoideum GN=DDB_G0267768 PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 5.919e-43
Identity = 93/259 (35.91%), Postives = 143/259 (55.21%), Query Frame = 3
Query:  156 THNGSFHCDEALGCFMIRLTDKFFNAQIVRSRDP-------------------------------------------------KHFGKELIAKELNVDEGHPDVHRLFLAVYKNFMEAIDAIDNGINQYDTDKPPRYVNNTNLSSRVGKLNLDWTEPDQSAERENEAFQQGMDLAGKEFLDTVRFYVRSWLPARSIVVECIAERYDYDPSGEIMVLKRFCPWKLHLFELEEEMKIEPLIKYVLYEDDRGKQWRVQAVAV 785
            TH+GSFH DEAL C++++L   + +++I+RSRD                                                  KH+GK++I + L+ ++   ++  L+  +Y + ++ +D +DNG+ +Y +D  PRY + +++S+RVG LN  W EP Q  E  N+ F++ M+L G+ FLD + +Y +SWLP RSIV   +  R     SGEI++L  FCPWK HLF LE+E  I+  IK+VL+ED  G QWRV AV +
Sbjct:    8 THSGSFHADEALACYLLKLLPTYKDSKIIRSRDKSVIEKSTVAVDVGAVYNFEKLRFDHHQSGFTETFDDKHDIKLSSAGLIYKHYGKDIIKQRLDTNDSITEL--LYQKLYDSMIQELDGVDNGVERYPSDIKPRYQSGSSISARVGHLNQGWNEP-QDDEIVNKQFEKAMELMGQYFLDRLDYYGKSWLPCRSIVENALENRKQTHSSGEILILDMFCPWKDHLFSLEQEKDIKTPIKFVLFEDTSG-QWRVSAVGI 262          
BLAST of FC928899 vs. ExPASy Swiss-Prot
Match: YEY6_YEAST (UPF0160 protein YER156C OS=Saccharomyces cerevisiae GN=YER156C PE=1 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 4.390e-38
Identity = 94/267 (35.21%), Postives = 141/267 (52.81%), Query Frame = 3
Query:  144 KRVGTHNGSFHCDEALGCFMIRLTDKFFNAQIVRSRDPK------------------------------------------------HFGKELIAKELNVDEGHPDVHRLFLAVYKNFMEAIDAIDNGINQY----DTDKPPRYVNNT-NLSSRVGKLNLDWTEPDQSAERENEAFQQGMDLAGKEFLDTVRFYVRSWLPARSIVVECIAERYDYDPSGEIMVLKRFCPWKLHLFELEEEMKIEPLIKYVLYEDDRGKQWRVQAVAV 785
            K++ TH+GSFH DE+L  +M+RL  +F +A++VRSR+PK                                                H+G+++I   LN      D+  L+  VYK F+EA+DA DNGI++Y    D++  P + +N  ++   +  +N +W E D S E  +  F +  +  G  F+  VR Y +SWLPA+++V + I ER D D SG+I+VL +FCPWK HL+ELE E  IE  I++VL+ D  G  WRV  V +
Sbjct:   15 KQICTHSGSFHADESLAVYMLRLLPEFKDAKLVRSRNPKDWEASDILVDVGAQYDGVKFFDHHQRGFFETFNEKYKTKLSSAGLIFKHYGRDIIKTILNNKVSSSDLDLLYDKVYKQFVEALDANDNGISKYTIPKDSNLEPNFRDNAISIPGIISGMNPNWNE-DTSDESFDRCFARASEFIGGVFVTLVRGYGQSWLPAKALVAQAIDERMDVDKSGKIIVLPQFCPWKEHLYELEREKNIEKQIEFVLFTDSSG-AWRVSTVPI 279          
BLAST of FC928899 vs. ExPASy Swiss-Prot
Match: MYG1_MOUSE (UPF0160 protein MYG1, mitochondrial OS=Mus musculus GN=Myg1 PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.412e-36
Identity = 79/174 (45.40%), Postives = 112/174 (64.37%), Query Frame = 3
Query:  261 HFGKELIAKELNVDEGHPDVHRLFLAVYKNFMEAIDAIDNGINQYDTDKPPRYVNNTNLSSRVGKLNLDWTEPDQSAERENEAFQQGMDLAGKEFLDTVRFYVRSWLPARSIVVECIAERYDYDPSGEIMVL-KRFCPWKLHLFELEEEMKIEPLIKYVLYEDDRGKQWRVQAV 779
            HFG++L+A+ L   E    V  ++  +Y+NF+E +DA+DNGI+Q+  +  PRY   T LS+RV +LN  W +P+Q  E     F++ MDL  +EFL  + FY  SWLPAR++V E +A+R+  D SGEI+ L K  CPWK HL+ LE E+  +  I +V+Y D  G QWRVQ V
Sbjct:  137 HFGRKLLAQLLGTSEEDSVVDTIYDKMYENFVEEVDAVDNGISQW-AEGEPRYAMTTTLSARVARLNPTWNQPNQDTEA---GFRRAMDLVQEEFLQRLNFYQHSWLPARALVEEALAQRFKVDSSGEIVELAKGGCPWKEHLYHLESELSPKVAITFVIYTDQAG-QWRVQCV 305          
BLAST of FC928899 vs. ExPASy Swiss-Prot
Match: MYG1_RAT (UPF0160 protein MYG1, mitochondrial OS=Rattus norvegicus GN=Myg1 PE=1 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.844e-36
Identity = 80/174 (45.98%), Postives = 110/174 (63.22%), Query Frame = 3
Query:  261 HFGKELIAKELNVDEGHPDVHRLFLAVYKNFMEAIDAIDNGINQYDTDKPPRYVNNTNLSSRVGKLNLDWTEPDQSAERENEAFQQGMDLAGKEFLDTVRFYVRSWLPARSIVVECIAERYDYDPSGEIMVL-KRFCPWKLHLFELEEEMKIEPLIKYVLYEDDRGKQWRVQAV 779
            HFG +L+A+ L   E    V  ++  +Y+NF+E +DA+DNGI+Q+  +  PRY   T LS+RV +LN  W +PDQ  E     F++ MDL  +EFL  + FY  SWLPAR++V E +A+R+  D SGEI+ L K  CPWK HL+ LE E+     I +V+Y D  G QWRVQ V
Sbjct:  138 HFGHKLLAQLLGTSEEDSVVDTIYDKMYENFVEEVDAVDNGISQW-AEGEPRYALTTTLSARVSRLNPTWNQPDQDTEA---GFRRAMDLVQEEFLQRLNFYQHSWLPARALVEEALAQRFKVDSSGEIVELAKGGCPWKEHLYHLESELSPTVAITFVIYTDQAG-QWRVQCV 306          
BLAST of FC928899 vs. ExPASy Swiss-Prot
Match: YIW4_SCHPO (UPF0160 protein C694.04c OS=Schizosaccharomyces pombe GN=SPAC694.04c PE=2 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 1.726e-34
Identity = 90/266 (33.83%), Postives = 130/266 (48.87%), Query Frame = 3
Query:  141 LKRVGTHNGSFHCDEALGCFMIRLTDKFFNAQIVRSRDP------------------------------------------------KHFGKELI---AKELNVDEGHPDVHRLFLAVYKNFMEAIDAIDNGINQYDTDKPPRYVNNTNLSSRVGKLNLDWTEPDQSAERENEAFQQGMDLAGKEFLDTVRFYVRSWLPARSIVVECIAERYDYDPSGEIMVLKRFCPWKLHLFELEEEMKIEPLIKYVLYEDDRGKQWRVQAVAV 785
            L ++ TH+G+FH DEAL  +M+R  D+F  AQIVRSRDP                                                KHFG+E+I     +L ++E   D+  L+  VY++F+E +DA DNGI+ Y     P +    +L   V      W    Q  +   E FQ+  DL G  F+ +V  Y  SWLPA+++  E I +  D      I+++ +F PWK HLF++E+E+ IE   KY +Y D  GK WRVQAV++
Sbjct:    4 LVKIATHSGTFHADEALAVYMLRRLDRFSGAQIVRSRDPQVLDSCDIIVDVGGKYDGIKYFDHHQREFNDTFSPKYSTRLSSAGLIYKHFGREVIHAVLPQLKINE--QDLETLYEKVYQSFVEGLDANDNGISAYPAGLKPSFKAAMSLPEMVSSFLPAWNSEKQDDQTYLECFQKASDLMGTWFVRSVEHYALSWLPAKTLAREAILKAKD----SPILIVDQFFPWKGHLFDIEKELGIENQFKYAIYSD--GKAWRVQAVSI 261          
BLAST of FC928899 vs. ExPASy Swiss-Prot
Match: YK4P_CAEEL (UPF0160 protein C27H6.8 OS=Caenorhabditis elegans GN=C27H6.8 PE=2 SV=2)

HSP 1 Score: 137.887 bits (346), Expect = 6.139e-32
Identity = 71/177 (40.11%), Postives = 107/177 (60.45%), Query Frame = 3
Query:  261 HFGKELIAKELNVDEGHPDVHRLFLAVYKNFMEAIDAIDNGINQYDTDKPPRYVNNTNLSSRVGKLNLDWTEPDQSAERENEAFQQGMDLAGKEFLDTVRFYVRSWLPARSIVVECIAERYDYDPSGEIMVLKR-FCPWKLHLFELEEEMKI-EPLIKYVLYEDDRGKQWRVQAVAV 785
            H+G+E+I + L  +     +   +  +Y+ F+E+IDAIDNGI+QYD    PRY ++ NLSSR G+ N  W EP+  A+   E FQQ M   G+EF  +V++    W PAR I+   + +R++ D SG I++++   CPWK H F++E E  I +  I Y+L+ D     WRVQA+ V
Sbjct:   95 HYGREVINQILGGNVSSSMIDLFYHRLYEQFVESIDAIDNGISQYDG--VPRYHSSGNLSSRTGQFNSHWNEPENDAD---ERFQQAMQFIGEEFSRSVKYLANVWWPAREIIEAAVDKRFEIDASGRIILIENGGCPWKEHFFDIEVEKNIADDNITYILFSDSTNASWRVQAIPV 266          
The following BLAST results are available for this feature:
BLAST of FC928899 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
MYG1_HUMAN1.558e-4338.72UPF0160 protein MYG1, mitochondrial OS=Homo sapien... [more]
MYG1_BOVIN2.034e-4338.72UPF0160 protein MYG1, mitochondrial OS=Bos taurus ... [more]
U160_DICDI5.919e-4335.91UPF0160 protein OS=Dictyostelium discoideum GN=DDB... [more]
YEY6_YEAST4.390e-3835.21UPF0160 protein YER156C OS=Saccharomyces cerevisia... [more]
MYG1_MOUSE1.412e-3645.40UPF0160 protein MYG1, mitochondrial OS=Mus musculu... [more]
MYG1_RAT1.844e-3645.98UPF0160 protein MYG1, mitochondrial OS=Rattus norv... [more]
YIW4_SCHPO1.726e-3433.83UPF0160 protein C694.04c OS=Schizosaccharomyces po... [more]
YK4P_CAEEL6.139e-3240.11UPF0160 protein C27H6.8 OS=Caenorhabditis elegans ... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3BA09RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3BA09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928899 ID=FC928899|Name=FC928899|organism=Citrus clementina|type=EST|length=785bp
GCGCAACCAAAGGGTTTAACCAGAAACTCTTCTTCTTCAGCGTGCACAAA
AACCTCTTCACTCGCCCTATCATAGCCATGGCAGGCACCGGTGTTTCTTC
TTCTCCTGCTTACTCCACTTCATCCCCCAGCCAAGCCCCTCTCAAGCGCG
TGGGCACCCACAACGGCAGCTTCCACTGCGACGAGGCCCTTGGTTGCTTC
ATGATTCGCCTCACTGACAAGTTCTTCAACGCCCAGATAGTCCGCTCCCG
CGACCCCAAGCATTTTGGAAAGGAGTTAATAGCTAAGGAACTTAATGTTG
ATGAAGGGCATCCAGACGTGCATCGACTATTTTTGGCTGTTTATAAGAAC
TTCATGGAGGCAATCGATGCTATTGATAACGGAATCAATCAGTATGACAC
AGACAAACCTCCAAGATATGTGAATAATACAAATTTGTCTTCTAGGGTGG
GGAAACTAAATTTGGATTGGACGGAACCTGATCAGTCAGCGGAGAGGGAG
AATGAAGCCTTCCAACAAGGAATGGATCTGGCTGGCAAAGAGTTTCTGGA
CACTGTTCGATTTTATGTGAGATCATGGTTACCAGCACGATCAATTGTAG
TGGAATGTATTGCAGAAAGATATGATTATGATCCAAGTGGTGAAATTATG
GTTTTGAAAAGATTTTGTCCTTGGAAGCTTCACTTGTTTGAGCTTGAGGA
GGAGATGAAGATTGAGCCTCTTATTAAATATGTTCTTTACGAGGACGACA
GGGGCAAACAATGGCGGGTGCAGGCTGTGGCAGTG
back to top