FC929929

Overview
NameFC929929
Unique NameFC929929
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length695
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15066 contig Ccv1_Contig15066:1..695. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929929 vs. ExPASy Swiss-Prot
Match: SPF30_XENTR (Survival of motor neuron-related-splicing factor 30 OS=Xenopus tropicalis GN=smndc1 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.050e-13
Identity = 60/176 (34.09%), Postives = 89/176 (50.57%), Query Frame = 3
Query:  114 EELFSNLSTYKEQLQQVRELLVHDPGNSEYADMEKELSEVIALTEELLATAKQNAISVSETGTSASASPNLLQSKENKTESGSISDNQEKLAVGTKVQAVYSEDGEWYDATIEAI-TPNG-YYVTYDSWGNKEEVDPANVRPVNLLVEAEKVAE-ATKLAIKRKIEQAAASDFQSK 632
            E+L   L+ YK QLQQV   L  +  N +   ++K+L EVI LT++LL++        SET   A          ++ + SGS     +   VG K  AV+S+DG+WY+A IE I   NG   +T+  +GN E     N+RPV    E  K  E +  L + +K   AA  +++ K
Sbjct:    3 EDLAKQLAGYKAQLQQVESALTANGENEDLLKLKKDLQEVIELTKDLLSS------QPSETADDAC---------DDMSASGS-----QSWKVGEKCMAVWSDDGQWYEAEIEEIDEENGTAAITFAGYGNAEVTSLLNLRPVE---EGRKAKEDSGNLPMSKKEMIAAQREYKKK 155          
BLAST of FC929929 vs. ExPASy Swiss-Prot
Match: SPF30_DANRE (Survival of motor neuron-related-splicing factor 30 OS=Danio rerio GN=smndc1 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.855e-11
Identity = 59/184 (32.07%), Postives = 88/184 (47.83%), Query Frame = 3
Query:  114 EELFSNLSTYKEQLQQVRELLVHDPGNSEYADMEKELSEVIALTEELLATAKQNAISVSETGTSASASPNLLQSKENKTESGSISDNQEKLAVGTKVQAVYSEDGEWYDATIEAI-TPNG-YYVTYDSWGNKEEVDPANVRPVNLL--VEAEKVAEATKLAIKRKIE-QAAASDFQSKSLPAKL 650
            EEL   LS YK QLQQV   L  DP N +   ++K+L EVI LT++LL +  Q A   + T +S + +P+                      VG    A +S+DG+ Y+A IE I   NG   +T+  +GN      A V P+++L  VE  ++ +      K K E QA   +++ K    K+
Sbjct:    3 EELMKQLSNYKAQLQQVEAALSIDPDNEDLLKLQKDLQEVIELTKDLLTS--QPAEGTTSTKSSETVAPS------------------HSWRVGDHCMATWSQDGQVYEAEIEEIDNENGTAAITFAGYGN------AEVMPLHMLKKVEEGRIRDEIDGKPKSKKELQAEQREYKKKKAQKKV 160          
BLAST of FC929929 vs. ExPASy Swiss-Prot
Match: SPF30_RAT (Survival of motor neuron-related-splicing factor 30 OS=Rattus norvegicus GN=Smndc1 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.728e-11
Identity = 55/168 (32.74%), Postives = 81/168 (48.21%), Query Frame = 3
Query:  114 EELFSNLSTYKEQLQQVRELLVHDPGNSEYADMEKELSEVIALTEELLATAKQNAISVSETGTSASASPNLLQSKENKTESGSISDNQ--EKLAVGTKVQAVYSEDGEWYDATIEAI-TPNG-YYVTYDSWGNKEEVDPANVRPVNLLVEAEKVAEATKLAIKRKIEQ 605
            E+L   L++YK QLQQV   L  +  N +   ++K+L EVI LT++LL+T                      Q  E  T S S +  Q      VG K  AV+SEDG+ Y+A IE I   NG   +T+  +GN E     N++PV    +A++ +    ++ K  I Q
Sbjct:    3 EDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLST----------------------QPSETLTSSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAVYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQ 148          
BLAST of FC929929 vs. ExPASy Swiss-Prot
Match: SPF30_HUMAN (Survival of motor neuron-related-splicing factor 30 OS=Homo sapiens GN=SMNDC1 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.728e-11
Identity = 53/166 (31.93%), Postives = 82/166 (49.40%), Query Frame = 3
Query:  114 EELFSNLSTYKEQLQQVRELLVHDPGNSEYADMEKELSEVIALTEELLATAKQNAISVSETGTSASASPNLLQSKENKTESGSISDNQEKLAVGTKVQAVYSEDGEWYDATIEAI-TPNG-YYVTYDSWGNKEEVDPANVRPVNLLVEAEKVAEATKLAIKRKIEQ 605
            E+L   L++YK QLQQV   L  +  N +   ++K+L EVI LT++LL+T     ++ S+  + AS  P                       VG K  AV+SEDG+ Y+A IE I   NG   +T+  +GN E     N++PV    +A++ +    ++ K  I Q
Sbjct:    3 EDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSD--SFASTQPT------------------HSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQ 148          
BLAST of FC929929 vs. ExPASy Swiss-Prot
Match: SPF30_PONAB (Survival of motor neuron-related-splicing factor 30 OS=Pongo abelii GN=SMNDC1 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.869e-11
Identity = 52/166 (31.33%), Postives = 82/166 (49.40%), Query Frame = 3
Query:  114 EELFSNLSTYKEQLQQVRELLVHDPGNSEYADMEKELSEVIALTEELLATAKQNAISVSETGTSASASPNLLQSKENKTESGSISDNQEKLAVGTKVQAVYSEDGEWYDATIEAI-TPNG-YYVTYDSWGNKEEVDPANVRPVNLLVEAEKVAEATKLAIKRKIEQ 605
            E+L   L++YK QLQQV   L  +  N +   ++K+L EVI LT++LL+T     ++ S+  + AS  P                       VG K  A++SEDG+ Y+A IE I   NG   +T+  +GN E     N++PV    +A++ +    ++ K  I Q
Sbjct:    3 EDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSD--SFASTQPT------------------HSWKVGDKCMAIWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQ 148          
BLAST of FC929929 vs. ExPASy Swiss-Prot
Match: SPF30_MOUSE (Survival of motor neuron-related-splicing factor 30 OS=Mus musculus GN=Smndc1 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.359e-11
Identity = 53/166 (31.93%), Postives = 82/166 (49.40%), Query Frame = 3
Query:  114 EELFSNLSTYKEQLQQVRELLVHDPGNSEYADMEKELSEVIALTEELLATAKQNAISVSETGTSASASPNLLQSKENKTESGSISDNQEKLAVGTKVQAVYSEDGEWYDATIEAI-TPNG-YYVTYDSWGNKEEVDPANVRPVNLLVEAEKVAEATKLAIKRKIEQ 605
            E+L   L++YK QLQQV   L  +  N +   ++K+L EVI LT++LL+T     ++ S+  + AS  P                       VG K  AV+SEDG+ Y+A IE I   NG   +T+  +GN E     N++PV    +A++ +    ++ K  I Q
Sbjct:    3 EDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSD--SFASTQPT------------------HSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAVYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQ 148          
BLAST of FC929929 vs. ExPASy Swiss-Prot
Match: SPF30_BOVIN (Survival of motor neuron-related-splicing factor 30 OS=Bos taurus GN=SMNDC1 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.359e-11
Identity = 52/166 (31.33%), Postives = 81/166 (48.80%), Query Frame = 3
Query:  114 EELFSNLSTYKEQLQQVRELLVHDPGNSEYADMEKELSEVIALTEELLATAKQNAISVSETGTSASASPNLLQSKENKTESGSISDNQEKLAVGTKVQAVYSEDGEWYDATIEAI-TPNG-YYVTYDSWGNKEEVDPANVRPVNLLVEAEKVAEATKLAIKRKIEQ 605
            E+L   L++YK QLQQV   L  +  N +   ++K+L EVI LT++LL+T     ++ S+    AS  P                       VG K  A++SEDG+ Y+A IE I   NG   +T+  +GN E     N++PV    +A++ +    ++ K  I Q
Sbjct:    3 EDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSD--NFASTQPT------------------HSWKVGDKCMAIWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQ 148          
The following BLAST results are available for this feature:
BLAST of FC929929 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
SPF30_XENTR3.050e-1334.09Survival of motor neuron-related-splicing factor 3... [more]
SPF30_DANRE2.855e-1132.07Survival of motor neuron-related-splicing factor 3... [more]
SPF30_RAT3.728e-1132.74Survival of motor neuron-related-splicing factor 3... [more]
SPF30_HUMAN3.728e-1131.93Survival of motor neuron-related-splicing factor 3... [more]
SPF30_PONAB4.869e-1131.33Survival of motor neuron-related-splicing factor 3... [more]
SPF30_MOUSE6.359e-1131.93Survival of motor neuron-related-splicing factor 3... [more]
SPF30_BOVIN6.359e-1131.33Survival of motor neuron-related-splicing factor 3... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34001H12EF PostHarvC1 Citrus clementina cDNA clone C34001H12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929929 ID=FC929929|Name=FC929929|organism=Citrus clementina|type=EST|length=695bp
GAGCTTGTTCTTTCGCTTTCTGTCTGTCTTGCTGTAATTCCATCTTCTTT
AATTTTCGATTCACAAAGTTAATTGAGTTAATAAAAATGCAAGGAGGAGA
AGAGCTGAGCATTGAAGAGCTCTTTTCAAATCTTTCTACTTATAAAGAGC
AGCTTCAACAGGTCAGAGAGCTGTTGGTTCATGATCCTGGAAACTCTGAA
TATGCTGACATGGAAAAGGAGCTGTCTGAGGTGATTGCCTTGACAGAGGA
ACTCCTTGCAACTGCAAAGCAAAATGCTATTTCTGTATCTGAAACTGGGA
CAAGTGCCAGTGCATCTCCTAATTTACTCCAGTCTAAGGAGAATAAAACA
GAATCAGGAAGCATATCTGATAATCAAGAGAAGCTTGCAGTGGGCACCAA
AGTTCAAGCTGTATATAGTGAAGATGGGGAATGGTATGATGCCACTATTG
AGGCAATCACGCCGAATGGATACTATGTTACTTATGACAGTTGGGGAAAT
AAGGAAGAGGTGGACCCTGCCAACGTAAGGCCTGTCAATCTATTGGTGGA
AGCTGAGAAGGTAGCTGAAGCTACTAAACTAGCTATCAAACGGAAGATTG
AACAAGCTGCTGCATCTGACTTTCAGTCTAAAAGCTTGCCAGCAAAACTT
CATATAAATCCCGATGATCCCGGAGATGTGAAAGCGGNCAAGCGT
back to top