FC931158

Overview
NameFC931158
Unique NameFC931158
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length730
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC931158_ssr21 microsatellite FC931158_ssr21:21..35. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig14460 contig Ccv1_Contig14460:72..801. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931158 vs. ExPASy Swiss-Prot
Match: SRR35_HUMAN (35 kDa SR repressor protein OS=Homo sapiens GN=SRRP35 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 6.465e-17
Identity = 41/91 (45.05%), Postives = 59/91 (64.84%), Query Frame = 1
Query:  193 SLLVRNIPLDCRPEELRAPFERFGVVRDVYLPKDYYTGEPRGFAFVQFVDPYEAAEAQHHMNGKRFAGREISVVLAAESRKRPEEMRQRHR 465
            SL +RN+    RPE+LR  F R+G + DVY+P D+YT  PRGFA+VQF D  +A +A +++N K   GR+I +  A   RK P +M+ + R
Sbjct:   11 SLFIRNVADATRPEDLRREFGRYGPIVDVYIPLDFYTRRPRGFAYVQFEDVRDAEDALYNLNRKWVCGRQIEIQFAQGDRKTPGQMKSKER 101          
BLAST of FC931158 vs. ExPASy Swiss-Prot
Match: SF13A_MOUSE (Splicing factor, arginine/serine-rich 13A OS=Mus musculus GN=Sfrs13a PE=1 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 1.103e-16
Identity = 41/89 (46.07%), Postives = 58/89 (65.17%), Query Frame = 1
Query:  193 SLLVRNIPLDCRPEELRAPFERFGVVRDVYLPKDYYTGEPRGFAFVQFVDPYEAAEAQHHMNGKRFAGREISVVLAAESRKRPEEMRQR 459
            SL VRN+  D R E+LR  F R+G + DVY+P D+YT  PRGFA+VQF D  +A +A H+++ K   GR+I +  A   RK P +M+ +
Sbjct:   11 SLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAK 99          
BLAST of FC931158 vs. ExPASy Swiss-Prot
Match: SF13A_HUMAN (Splicing factor, arginine/serine-rich 13A OS=Homo sapiens GN=SFRS13A PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.103e-16
Identity = 41/89 (46.07%), Postives = 58/89 (65.17%), Query Frame = 1
Query:  193 SLLVRNIPLDCRPEELRAPFERFGVVRDVYLPKDYYTGEPRGFAFVQFVDPYEAAEAQHHMNGKRFAGREISVVLAAESRKRPEEMRQR 459
            SL VRN+  D R E+LR  F R+G + DVY+P D+YT  PRGFA+VQF D  +A +A H+++ K   GR+I +  A   RK P +M+ +
Sbjct:   11 SLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAK 99          
BLAST of FC931158 vs. ExPASy Swiss-Prot
Match: SFRS2_RAT (Splicing factor, arginine/serine-rich 2 OS=Rattus norvegicus GN=Sfrs2 PE=1 SV=3)

HSP 1 Score: 70.0922 bits (170), Expect = 1.395e-11
Identity = 37/80 (46.25%), Postives = 49/80 (61.25%), Query Frame = 1
Query:  193 SLLVRNIPLDCRPEELRAPFERFGVVRDVYLPKDYYTGEPRGFAFVQFVDPYEAAEAQHHMNGKRFAGREISVVLAAESR 432
            SL V N+     P+ LR  FE++G V DVY+P+D YT E RGFAFV+F D  +A +A   M+G    GRE+ V +A   R
Sbjct:   15 SLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGR 94          
BLAST of FC931158 vs. ExPASy Swiss-Prot
Match: SFRS2_PIG (Splicing factor, arginine/serine-rich 2 OS=Sus scrofa GN=SFRS2 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.395e-11
Identity = 37/80 (46.25%), Postives = 49/80 (61.25%), Query Frame = 1
Query:  193 SLLVRNIPLDCRPEELRAPFERFGVVRDVYLPKDYYTGEPRGFAFVQFVDPYEAAEAQHHMNGKRFAGREISVVLAAESR 432
            SL V N+     P+ LR  FE++G V DVY+P+D YT E RGFAFV+F D  +A +A   M+G    GRE+ V +A   R
Sbjct:   15 SLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGR 94          
BLAST of FC931158 vs. ExPASy Swiss-Prot
Match: SFRS2_PANTR (Splicing factor, arginine/serine-rich 2 OS=Pan troglodytes GN=SFRS2 PE=2 SV=3)

HSP 1 Score: 70.0922 bits (170), Expect = 1.395e-11
Identity = 37/80 (46.25%), Postives = 49/80 (61.25%), Query Frame = 1
Query:  193 SLLVRNIPLDCRPEELRAPFERFGVVRDVYLPKDYYTGEPRGFAFVQFVDPYEAAEAQHHMNGKRFAGREISVVLAAESR 432
            SL V N+     P+ LR  FE++G V DVY+P+D YT E RGFAFV+F D  +A +A   M+G    GRE+ V +A   R
Sbjct:   15 SLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGR 94          
BLAST of FC931158 vs. ExPASy Swiss-Prot
Match: SFRS2_MOUSE (Splicing factor, arginine/serine-rich 2 OS=Mus musculus GN=Sfrs2 PE=1 SV=4)

HSP 1 Score: 70.0922 bits (170), Expect = 1.395e-11
Identity = 37/80 (46.25%), Postives = 49/80 (61.25%), Query Frame = 1
Query:  193 SLLVRNIPLDCRPEELRAPFERFGVVRDVYLPKDYYTGEPRGFAFVQFVDPYEAAEAQHHMNGKRFAGREISVVLAAESR 432
            SL V N+     P+ LR  FE++G V DVY+P+D YT E RGFAFV+F D  +A +A   M+G    GRE+ V +A   R
Sbjct:   15 SLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGR 94          
BLAST of FC931158 vs. ExPASy Swiss-Prot
Match: SFRS2_HUMAN (Splicing factor, arginine/serine-rich 2 OS=Homo sapiens GN=SFRS2 PE=1 SV=4)

HSP 1 Score: 70.0922 bits (170), Expect = 1.395e-11
Identity = 37/80 (46.25%), Postives = 49/80 (61.25%), Query Frame = 1
Query:  193 SLLVRNIPLDCRPEELRAPFERFGVVRDVYLPKDYYTGEPRGFAFVQFVDPYEAAEAQHHMNGKRFAGREISVVLAAESR 432
            SL V N+     P+ LR  FE++G V DVY+P+D YT E RGFAFV+F D  +A +A   M+G    GRE+ V +A   R
Sbjct:   15 SLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGR 94          
BLAST of FC931158 vs. ExPASy Swiss-Prot
Match: SFRS2_CHICK (Splicing factor, arginine/serine-rich 2 OS=Gallus gallus GN=SFRS2 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.395e-11
Identity = 37/80 (46.25%), Postives = 49/80 (61.25%), Query Frame = 1
Query:  193 SLLVRNIPLDCRPEELRAPFERFGVVRDVYLPKDYYTGEPRGFAFVQFVDPYEAAEAQHHMNGKRFAGREISVVLAAESR 432
            SL V N+     P+ LR  FE++G V DVY+P+D YT E RGFAFV+F D  +A +A   M+G    GRE+ V +A   R
Sbjct:   15 SLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGR 94          
BLAST of FC931158 vs. ExPASy Swiss-Prot
Match: SFRS2_BOVIN (Splicing factor, arginine/serine-rich 2 OS=Bos taurus GN=SFRS2 PE=2 SV=3)

HSP 1 Score: 70.0922 bits (170), Expect = 1.395e-11
Identity = 37/80 (46.25%), Postives = 49/80 (61.25%), Query Frame = 1
Query:  193 SLLVRNIPLDCRPEELRAPFERFGVVRDVYLPKDYYTGEPRGFAFVQFVDPYEAAEAQHHMNGKRFAGREISVVLAAESR 432
            SL V N+     P+ LR  FE++G V DVY+P+D YT E RGFAFV+F D  +A +A   M+G    GRE+ V +A   R
Sbjct:   15 SLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGR 94          
The following BLAST results are available for this feature:
BLAST of FC931158 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
SRR35_HUMAN6.465e-1745.0535 kDa SR repressor protein OS=Homo sapiens GN=SRR... [more]
SF13A_MOUSE1.103e-1646.07Splicing factor, arginine/serine-rich 13A OS=Mus m... [more]
SF13A_HUMAN1.103e-1646.07Splicing factor, arginine/serine-rich 13A OS=Homo ... [more]
SFRS2_RAT1.395e-1146.25Splicing factor, arginine/serine-rich 2 OS=Rattus ... [more]
SFRS2_PIG1.395e-1146.25Splicing factor, arginine/serine-rich 2 OS=Sus scr... [more]
SFRS2_PANTR1.395e-1146.25Splicing factor, arginine/serine-rich 2 OS=Pan tro... [more]
SFRS2_MOUSE1.395e-1146.25Splicing factor, arginine/serine-rich 2 OS=Mus mus... [more]
SFRS2_HUMAN1.395e-1146.25Splicing factor, arginine/serine-rich 2 OS=Homo sa... [more]
SFRS2_CHICK1.395e-1146.25Splicing factor, arginine/serine-rich 2 OS=Gallus ... [more]
SFRS2_BOVIN1.395e-1146.25Splicing factor, arginine/serine-rich 2 OS=Bos tau... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34102B02EF PostHarvP1 Citrus clementina cDNA clone C34102B02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931158 ID=FC931158|Name=FC931158|organism=Citrus clementina|type=EST|length=730bp
GAATCTAGTTGCAAAGTCTTCTCTCCTCTCCTCTCTTGTCTTTCTCGTAC
AGGCTGTGCTATGAGAAGGTACAGTCCACCATACTACAGTCCTCCGAGGA
GGGGATACGGAGGCCGAGGAAGAAGCCCTCCGAGAAGAGGATACGGTGGC
GGTGGAGGAGGCTATGGAAGACGCAAGGAACAGAATCATGGTAGCCTTTT
GGTTCGAAACATTCCGCTTGATTGCAGGCCTGAAGAACTCCGTGCTCCGT
TCGAGAGGTTTGGGGTTGTTAGGGATGTCTACCTTCCTAAGGATTACTAC
ACTGGGGAACCTCGAGGGTTTGCGTTTGTGCAATTTGTGGATCCTTATGA
AGCTGCTGAAGCTCAACACCATATGAATGGGAAACGTTTTGCTGGGAGGG
AAATATCTGTAGTCCTTGCTGCAGAGTCAAGGAAAAGGCCGGAGGAGATG
CGGCAAAGACATAGGTTTAGAGGAGGGTCGAGCTATGGAGGACCGCGATC
ATCTTATTATGGACGTTATCGGTCCCGTTCACTATCCCGTTCACGTTCCC
CTCATCATCCTCAAGGTTCTAGAAGCCGGTACCGCTCTAGATCTTACACT
CCTGGTCCCAGACAACACGAAGAATTACTCATTTCTCCTCGGAGAAGGCA
CATAGAACACCCAGGATCACCAAGAGGTCCTCCANCAGAGCGAGGTGTTG
AATACAGTCGTAGATCATATTCTCCTGGAT
back to top