FC931236

Overview
NameFC931236
Unique NameFC931236
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length691
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig679 contig Ccv1_Contig679:252..942. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931236 vs. ExPASy Swiss-Prot
Match: Y615_SYNY3 (UPF0016 membrane protein sll0615 OS=Synechocystis sp. (strain PCC 6803) GN=sll0615 PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.148e-28
Identity = 45/78 (57.69%), Postives = 55/78 (70.51%), Query Frame = 1
Query:  454 IFLESFILTFLAEWGDRSQIATIALATHKNAVGVAVGATIGHTICTSLAVVGGSMLASKF-HTYGCYIGGLLFFAFPV 684
            I +ESF LTF+AEWGDR+QIATIALA   NA GV+ GA +GHTIC  +AV+GG  +A +        IGGLLF+ F V
Sbjct:  121 IVVESFALTFVAEWGDRTQIATIALAASNNAWGVSAGAILGHTICAVIAVMGGKFVAGRISEKTVTLIGGLLFYLFAV 198          

HSP 2 Score: 60.4622 bits (145), Expect = 1.148e-28
Identity = 35/95 (36.84%), Postives = 54/95 (56.84%), Query Frame = 3
Query:   84 AFIASFSMIIVSEIGDETFIIAALMAMRHPKSTVLSGALSALFVMTVLSTGLGRIVPNLISRKHTNSAATVLYAFFWAAVTIHSLDVRSKIRSEE 368
            AF A   +I VSE+GD+TF IA ++AMR+P+  VL G +  L  MT+LS  +G+I   L +R + N A   L+  F   +   +  +++    EE
Sbjct:    4 AFTAGLLLITVSELGDKTFFIAMILAMRYPRRWVLVGVVGGLAAMTILSVLMGQIFTFLPTR-YINYAEVALFLIFGTKLLWDARRIKATANLEE 97          
BLAST of FC931236 vs. ExPASy Swiss-Prot
Match: TM165_RAT (Transmembrane protein 165 OS=Rattus norvegicus GN=Tmem165 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 5.326e-18
Identity = 44/80 (55.00%), Postives = 56/80 (70.00%), Query Frame = 1
Query:  451 PIFLESFILTFLAEWGDRSQIATIALATHKNAVGVAVGATIGHTICTSLAVVGGSMLASKFHTYG-CYIGGLLFFAFPVS 687
            PIF+++  LTFLAEWGDRSQ+ TI LA  ++  GVAVG T+GH +CT LAV+GG M+A K        IGG++F AF  S
Sbjct:  234 PIFVQALTLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTVTIIGGIVFLAFAFS 313          

HSP 2 Score: 74.3294 bits (181), Expect = 6.679e-13
Identity = 41/83 (49.40%), Postives = 57/83 (68.67%), Query Frame = 3
Query:   63 SGLGVFDAFIASFSMIIVSEIGDETFIIAALMAMRHPKSTVLSGALSALFVMTVLSTGLGRIVPNLISRKHTNSAATVLYAFF 311
            + LG   AF+A+ S+IIVSE+GD+TF IAA+MAMR+ + TVL+GA+ AL +MT LS   G     +I R +T   +T L+A F
Sbjct:   89 ANLGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALALMTCLSVLFG-YATTVIPRVYTYYVSTALFAIF 170          
BLAST of FC931236 vs. ExPASy Swiss-Prot
Match: TM165_MOUSE (Transmembrane protein 165 OS=Mus musculus GN=Tmem165 PE=2 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 5.326e-18
Identity = 44/80 (55.00%), Postives = 56/80 (70.00%), Query Frame = 1
Query:  451 PIFLESFILTFLAEWGDRSQIATIALATHKNAVGVAVGATIGHTICTSLAVVGGSMLASKFHTYG-CYIGGLLFFAFPVS 687
            PIF+++  LTFLAEWGDRSQ+ TI LA  ++  GVAVG T+GH +CT LAV+GG M+A K        IGG++F AF  S
Sbjct:  234 PIFVQALTLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTVTIIGGIVFLAFAFS 313          

HSP 2 Score: 74.3294 bits (181), Expect = 6.679e-13
Identity = 41/83 (49.40%), Postives = 57/83 (68.67%), Query Frame = 3
Query:   63 SGLGVFDAFIASFSMIIVSEIGDETFIIAALMAMRHPKSTVLSGALSALFVMTVLSTGLGRIVPNLISRKHTNSAATVLYAFF 311
            + LG   AF+A+ S+IIVSE+GD+TF IAA+MAMR+ + TVL+GA+ AL +MT LS   G     +I R +T   +T L+A F
Sbjct:   89 TNLGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALALMTCLSVLFG-YATTVIPRVYTYYVSTALFAIF 170          
BLAST of FC931236 vs. ExPASy Swiss-Prot
Match: TM165_HUMAN (Transmembrane protein 165 OS=Homo sapiens GN=TMEM165 PE=1 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 5.326e-18
Identity = 44/80 (55.00%), Postives = 56/80 (70.00%), Query Frame = 1
Query:  451 PIFLESFILTFLAEWGDRSQIATIALATHKNAVGVAVGATIGHTICTSLAVVGGSMLASKFHTYG-CYIGGLLFFAFPVS 687
            PIF+++  LTFLAEWGDRSQ+ TI LA  ++  GVAVG T+GH +CT LAV+GG M+A K        IGG++F AF  S
Sbjct:  235 PIFVQALTLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTVTIIGGIVFLAFAFS 314          

HSP 2 Score: 75.485 bits (184), Expect = 2.998e-13
Identity = 42/83 (50.60%), Postives = 58/83 (69.88%), Query Frame = 3
Query:   63 SGLGVFDAFIASFSMIIVSEIGDETFIIAALMAMRHPKSTVLSGALSALFVMTVLSTGLGRIVPNLISRKHTNSAATVLYAFF 311
            + LG   AF+A+ S+IIVSE+GD+TF IAA+MAMR+ + TVL+GA+ AL +MT LS   G     +I R +T   +TVL+A F
Sbjct:   89 TNLGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALGLMTCLSVLFG-YATTVIPRVYTYYVSTVLFAIF 170          
BLAST of FC931236 vs. ExPASy Swiss-Prot
Match: YD68_SCHPO (UPF0016 membrane protein C17G8.08c OS=Schizosaccharomyces pombe GN=SPAC17G8.08c PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 9.084e-18
Identity = 41/81 (50.62%), Postives = 59/81 (72.84%), Query Frame = 1
Query:  451 PIFLESFILTFLAEWGDRSQIATIALATHKNAVGVAVGATIGHTICTSLAVVGGSMLASKFHTYG-CYIGGLLFFAFPVSY 690
            P+F+++F LTF++EWGDRSQIATIA+A   N  GV +GA +GH  CT+LAV+ G  +++K   +   +IGG+LF AF + Y
Sbjct:  201 PLFIKAFALTFVSEWGDRSQIATIAMAASDNVYGVFMGANVGHACCTALAVISGKYISTKIKVHKVMFIGGILFIAFGLVY 281          

HSP 2 Score: 68.1662 bits (165), Expect = 4.787e-11
Identity = 37/87 (42.53%), Postives = 53/87 (60.92%), Query Frame = 3
Query:   84 AFIASFSMIIVSEIGDETFIIAALMAMRHPKSTVLSGALSALFVMTVLSTGLGRIVPNLISRKHTNSAATVLYAFFWAAVTIHSLDV 344
            + I S SMI   EIGD+TFI+AAL+A  + + TV +G+ SALF+MT+L   LG   P L  RK T+    VL+  F   + + + +V
Sbjct:   49 SLIFSISMIFGCEIGDKTFIVAALLAFENSRLTVFAGSYSALFIMTLLGVLLGHAAPLLFPRKLTDILGGVLFVIFGIKMLMEAKEV 135          
BLAST of FC931236 vs. ExPASy Swiss-Prot
Match: YB37_YEAST (UPF0016 membrane protein YBR187W OS=Saccharomyces cerevisiae GN=YBR187W PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 4.367e-12
Identity = 37/81 (45.68%), Postives = 52/81 (64.20%), Query Frame = 1
Query:  451 PIFLESFILTFLAEWGDRSQIATIALATHKNAVGVAVGATIGHTICTSLAVVGGSMLASKFHTYGCYI-GGLLFFAFPVSY 690
            P++++ F++ FL E GDRSQI+ IA+AT  +   V  GA IGH IC+ LAVVGG +LA++       +   LLFF F + Y
Sbjct:  191 PVWVQIFLMVFLGELGDRSQISIIAMATDSDYWYVIAGAVIGHAICSGLAVVGGKLLATRISIRTITLASSLLFFIFALMY 271          

HSP 2 Score: 71.2478 bits (173), Expect = 5.654e-12
Identity = 39/95 (41.05%), Postives = 59/95 (62.11%), Query Frame = 3
Query:   84 AFIASFSMIIVSEIGDETFIIAALMAMRHPKSTVLSGALSALFVMTVLSTGLGRIVPNLISRKHTNSAATVLYAFFWAAVTIHSLDVRSKIRSEE 368
            +F+ S SMI +SEIGD+TF+IAALMAMRH +  V S A ++L +MT+LS  +G      +S ++T   A +L+  F   +T+  L++      EE
Sbjct:   41 SFLMSVSMIGLSEIGDKTFLIAALMAMRHKRVLVFSAAATSLAIMTILSGVVGHSAVAFLSERYTAFFAGILFLVFGYKLTMEGLEMSKDAGVEE 135          
BLAST of FC931236 vs. ExPASy Swiss-Prot
Match: YLY5_SCHPO (UPF0016 membrane protein C186.05c OS=Schizosaccharomyces pombe GN=SPAC186.05c PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.697e-11
Identity = 31/79 (39.24%), Postives = 51/79 (64.56%), Query Frame = 1
Query:  457 FLESFILTFLAEWGDRSQIATIALATHKNAVGVAVGATIGHTICTSLAVVGGSMLASKFHTYG-CYIGGLLFFAFPVSY 690
            F+++F L F++E GDRSQIATI ++  +  + V +G  IGH +CT +AV+ G  +++K   Y   + GG++F  F + Y
Sbjct:  179 FIKAFALIFVSELGDRSQIATIVMSAKEKVLDVFIGVNIGHMLCTMVAVIVGRYISNKIEMYKVLFFGGIVFMIFGILY 257          
The following BLAST results are available for this feature:
BLAST of FC931236 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
Y615_SYNY31.148e-2857.69UPF0016 membrane protein sll0615 OS=Synechocystis ... [more]
TM165_RAT5.326e-1855.00Transmembrane protein 165 OS=Rattus norvegicus GN=... [more]
TM165_MOUSE5.326e-1855.00Transmembrane protein 165 OS=Mus musculus GN=Tmem1... [more]
TM165_HUMAN5.326e-1855.00Transmembrane protein 165 OS=Homo sapiens GN=TMEM1... [more]
YD68_SCHPO9.084e-1850.62UPF0016 membrane protein C17G8.08c OS=Schizosaccha... [more]
YB37_YEAST4.367e-1245.68UPF0016 membrane protein YBR187W OS=Saccharomyces ... [more]
YLY5_SCHPO3.697e-1139.24UPF0016 membrane protein C186.05c OS=Schizosacchar... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34103A03EF PostHarvP1 Citrus clementina cDNA clone C34103A03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931236 ID=FC931236|Name=FC931236|organism=Citrus clementina|type=EST|length=691bp
GTGGCTTGATTTTATCGCAAGACCTTGAGAATGAACTCGGTACGATCCCT
TTGAATATCGACTCGGGTCTTGGAGTTTTTGATGCCTTCATCGCAAGTTT
TTCGATGATCATTGTTAGTGAGATTGGAGATGAGACTTTCATAATAGCAG
CACTTATGGCAATGCGTCATCCCAAGTCAACCGTTTTGTCGGGTGCGCTC
TCTGCTCTGTTTGTTATGACTGTACTTTCTACTGGACTAGGTAGGATTGT
GCCGAACTTGATATCAAGGAAGCATACAAATAGTGCTGCTACAGTTCTGT
ATGCATTTTTTTGGGCTGCGGTTACTATACATAGCTTGGATGTCAGATCC
AAAATCAGGTCAGAAGAAAGAAATGGAGGAGGTGGAGGAGAAACTTGAGT
CAGGGCAAGGGAAGACAACCTTCCGCCGTTTCTTCTCAAGATTCTGTACT
CCCATATTTCTAGAGTCATTTATTTTGACATTCCTGGCAGAGTGGGGAGA
TCGTAGCCAGATAGCCACAATTGCTTTGGCAACACACAAAAATGCCGTTG
GAGTTGCAGTTGGGGCCACAATAGGACACACAATCTGTACATCACTGGCC
GTGGTGGGTGGGAGCATGCTGGCGTCAAAATTTCACACGTACGGTTGCTA
CATAGGAGGCTTGCTCTTCTTTGCTTTTCCTGTCTCATACT
back to top