BQ622921
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of BQ622921 vs. ExPASy Swiss-Prot
Match: Y5258_ARATH (Uncharacterized protein At5g22580 OS=Arabidopsis thaliana GN=At5g22580 PE=1 SV=1) HSP 1 Score: 112.849 bits (281), Expect = 5.125e-29 Identity = 53/81 (65.43%), Postives = 62/81 (76.54%), Query Frame = 1 Query: 73 KG*KSLVSEIDAVKSFEWGQDVEGQEMLRQGFTHAFLMTFNKKEDYTTFASHPSHVEFSATFSAAIEKIVLLDFPTVLGKA 315 KG ++LVS+ID VKSFEWG+D E +MLRQGFTHAF MTF K+ Y F SHP HVEFSA F+A I+KIVLLDFP K+ Sbjct: 25 KGLENLVSQIDTVKSFEWGEDKESHDMLRQGFTHAFSMTFENKDGYVAFTSHPLHVEFSAAFTAVIDKIVLLDFPVAAVKS 105 HSP 2 Score: 35.4242 bits (80), Expect = 5.125e-29 Identity = 15/27 (55.56%), Postives = 21/27 (77.78%), Query Frame = 3 Query: 3 AMGEFKHLVIVKFKEGVVVEDIVKGMK 83 A FKHLV+VKFKE V++I+KG++ Sbjct: 2 ATSGFKHLVVVKFKEDTKVDEILKGLE 28
BLAST of BQ622921 vs. ExPASy Swiss-Prot
Match: POP3_ARATH (Probable protein Pop3 OS=Arabidopsis thaliana GN=At3g17210 PE=1 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 1.066e-13 Identity = 32/76 (42.11%), Postives = 51/76 (67.11%), Query Frame = 1 Query: 67 LSKG*KSLVSEIDAVKSFEWGQDVEGQEMLRQGFTHAFLMTFNKKEDYTTFASHPSHVEFSATFSAAIEKIVLLDF 294 L KG +LV+ I+ +K+F WG+DV E L QG+TH F TF KE + +HP+HVEF+ F +++K++++D+ Sbjct: 28 LIKGYANLVNLIEPMKAFHWGKDVS-IENLHQGYTHIFESTFESKEAVAEYIAHPAHVEFATIFLGSLDKVLVIDY 102 HSP 2 Score: 26.5646 bits (57), Expect = 1.066e-13 Identity = 11/28 (39.29%), Postives = 19/28 (67.86%), Query Frame = 3 Query: 3 AMGEFKHLVIVKFKEGV---VVEDIVKG 77 A G KH+++ FK+GV +E+++KG Sbjct: 4 AKGPVKHVLLASFKDGVSPEKIEELIKG 31 The following BLAST results are available for this feature:
BLAST of BQ622921 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ622921 ID=BQ622921; Name=BQ622921; organism=Citrus sinensis; type=EST; length=622bpback to top |