BQ623020

Overview
NameBQ623020
Unique NameBQ623020
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length480
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11002 contig Csv1_Contig11002:300..778. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623020 vs. ExPASy Swiss-Prot
Match: CB4A_SOLLC (Chlorophyll a-b binding protein CP24 10A, chloroplastic OS=Solanum lycopersicum GN=CAP10A PE=3 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 5.246e-82
Identity = 135/148 (91.22%), Postives = 145/148 (97.97%), Query Frame = 2
Query:    2 SLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDR 445
            SLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAV+GIFVGQAWSGIPWFEAGADPGAIAPFSFG+LLGTQL+LMGWVESKRWVDFF+P+SQSVEWATPWS+TAENFAN TGEQGYPGGKFFDPL LAGT+ +GVY+PDTEKL+R
Sbjct:   74 SLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGIPWFEAGADPGAIAPFSFGTLLGTQLILMGWVESKRWVDFFDPDSQSVEWATPWSKTAENFANFTGEQGYPGGKFFDPLALAGTLNNGVYVPDTEKLER 221          

HSP 2 Score: 25.0238 bits (53), Expect = 5.246e-82
Identity = 12/14 (85.71%), Postives = 12/14 (85.71%), Query Frame = 3
Query:  438 LTGLKVAEIKHARL 479
            L  LKVAEIKHARL
Sbjct:  219 LERLKVAEIKHARL 232          
BLAST of BQ623020 vs. ExPASy Swiss-Prot
Match: CB4B_SOLLC (Chlorophyll a-b binding protein CP24 10B, chloroplastic OS=Solanum lycopersicum GN=CAP10B PE=3 SV=1)

HSP 1 Score: 295.434 bits (755), Expect = 6.265e-80
Identity = 133/148 (89.86%), Postives = 144/148 (97.30%), Query Frame = 2
Query:    2 SLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDR 445
            SLPGD+GFDPLGLGKDPAFLKWYREAELIHGRWAMAAV+GIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWS+TAENFAN TGEQGYPGGKFFDPL LAGT+ +GVY+PDTEKL+R
Sbjct:   74 SLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAENFANFTGEQGYPGGKFFDPLALAGTLNNGVYVPDTEKLER 221          

HSP 2 Score: 22.7126 bits (47), Expect = 6.265e-80
Identity = 10/14 (71.43%), Postives = 12/14 (85.71%), Query Frame = 3
Query:  438 LTGLKVAEIKHARL 479
            L  LK+AEIKH+RL
Sbjct:  219 LERLKLAEIKHSRL 232          
BLAST of BQ623020 vs. ExPASy Swiss-Prot
Match: CB4_SPIOL (Chlorophyll a-b binding protein CP24, chloroplastic OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 8.170e-80
Identity = 132/148 (89.19%), Postives = 144/148 (97.30%), Query Frame = 2
Query:    2 SLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDR 445
            SLPGD+GFDPLGLGKDPAFLKWYREAELIHGRWAM AV+GIFVGQAW+GIPWFEAGADPGA+APFSFG+LLGTQLLLMGWVESKRWVDFF+P+SQSVEWATPWSRTAENF+N+TGEQGYPGGKFFDPL LAGTI +GVY PDT+KL+R
Sbjct:   79 SLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMLAVLGIFVGQAWTGIPWFEAGADPGAVAPFSFGTLLGTQLLLMGWVESKRWVDFFDPDSQSVEWATPWSRTAENFSNSTGEQGYPGGKFFDPLSLAGTISNGVYNPDTDKLER 226          

HSP 2 Score: 23.8682 bits (50), Expect = 8.170e-80
Identity = 11/14 (78.57%), Postives = 12/14 (85.71%), Query Frame = 3
Query:  438 LTGLKVAEIKHARL 479
            L  LK+AEIKHARL
Sbjct:  224 LERLKLAEIKHARL 237          
BLAST of BQ623020 vs. ExPASy Swiss-Prot
Match: CB12_PETHY (Chlorophyll a-b binding protein, chloroplastic OS=Petunia hybrida PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 8.910e-21
Identity = 53/134 (39.55%), Postives = 71/134 (52.99%), Query Frame = 2
Query:    2 SLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGI------PWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPL 385
            SLPGD+GFDPLGLG DP  LKW  +AEL+H RWAM    GIF+ +  + I       W+ AG            +L   +L+L+GW E +RW D   P   + +   P ++          + GYPGG +FDPL
Sbjct:   81 SLPGDFGFDPLGLGSDPESLKWNAQAELVHSRWAMLGAAGIFIPEFLTKIGVLNTPSWYTAGEQEYFT---DTTTLFVIELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGT------DVGYPGGLWFDPL 205          
BLAST of BQ623020 vs. ExPASy Swiss-Prot
Match: CB12_SOLLC (Chlorophyll a-b binding protein 7, chloroplastic OS=Solanum lycopersicum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 9.851e-20
Identity = 51/134 (38.06%), Postives = 71/134 (52.99%), Query Frame = 2
Query:    2 SLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGI------PWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPL 385
            SLPGD+GFDPLGL  DP  L+W ++AEL+H RWAM    GIF+ +  + I       W+ AG            +L   +L+L+GW E +RW D   P   + +   P ++          + GYPGG +FDPL
Sbjct:   81 SLPGDFGFDPLGLASDPESLRWNQQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFT---DTTTLFIVELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGT------DVGYPGGLWFDPL 205          
BLAST of BQ623020 vs. ExPASy Swiss-Prot
Match: CB24_PEA (Chlorophyll a-b binding protein P4, chloroplastic OS=Pisum sativum GN=lhcA-P4 PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.858e-18
Identity = 53/141 (37.59%), Postives = 79/141 (56.03%), Query Frame = 2
Query:    2 SLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGI------PWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIK 406
            SLPGD GFDPLGL +DP  L+W+ +AEL++GRWAM  V G+ + + ++ I       W+ AG +       S  +L   + +L  +VE +RW D  NP S + +         + ++   GE GYPGG  F+PL  A T++
Sbjct:   69 SLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYAAGKEEYFA---SSSTLFVIEFILSHYVEIRRWQDIKNPGSVNQD------PIFKQYSLPAGEVGYPGG-IFNPLNFAPTLE 199          
BLAST of BQ623020 vs. ExPASy Swiss-Prot
Match: CB24_ARATH (Chlorophyll a-b binding protein 4, chloroplastic OS=Arabidopsis thaliana GN=CAB4 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.204e-17
Identity = 53/139 (38.13%), Postives = 77/139 (55.40%), Query Frame = 2
Query:    2 SLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGI------PWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGT 400
            SL GD GFDPLGL +DP  LKW+ +AEL++GRWAM  V G+ + + ++ I       W++AG +       S  +L   + +L  +VE +RW D  NP S + +         + ++   GE GYPGG  F+PL  A T
Sbjct:   70 SLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKIGIINVPEWYDAGKEQYFA---SSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQD------PIFKQYSLPKGEVGYPGG-IFNPLNFAPT 198          
BLAST of BQ623020 vs. ExPASy Swiss-Prot
Match: CB4B_ARATH (Chlorophyll a-b binding protein CP29.2, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.2 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 4.573e-13
Identity = 55/182 (30.22%), Postives = 76/182 (41.76%), Query Frame = 2
Query:    2 SLPGDYGFDPLGLGKDPAFLKW-------------------------------------------YREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAG--------ADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLA 394
            SL GDYGFDP GLGK   +L++                                           +RE ELIHGRWAM A +G    +  +G+ W +AG        +  G   PFS  +L+  ++L++G++E +R     N E  S                   ++ YPGGKFFDPL LA
Sbjct:   68 SLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLYGEVIGTRTEAVDPKSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGAITVEWLTGVTWQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVIGYIEFQR-----NAELDS------------------EKRLYPGGKFFDPLGLA 226          

HSP 2 Score: 21.9422 bits (45), Expect = 4.573e-13
Identity = 9/11 (81.82%), Postives = 11/11 (100.00%), Query Frame = 3
Query:  447 LKVAEIKHARL 479
            L++AEIKHARL
Sbjct:  235 LQLAEIKHARL 245          
BLAST of BQ623020 vs. ExPASy Swiss-Prot
Match: CB23_HORVU (Chlorophyll a-b binding protein of LHCII type III, chloroplastic OS=Hordeum vulgare GN=LHBC PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 3.394e-12
Identity = 53/151 (35.10%), Postives = 67/151 (44.37%), Query Frame = 2
Query:    8 PGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIF---VGQAWSGIP-----WFEAGA------------DPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQG--YPGGKFFDPLCLA 394
            PGDYG+D  GL  DP      R  E+IHGRWAM   +G     V Q W G+      WF+AG+            +P  +   S  ++LG Q+LLMG VE  R                       N  +  GE    YPGG++FDPL LA
Sbjct:   75 PGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGALGCVFPEVLQKWVGVEFKEPVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAVLGFQVLLMGLVEGFR----------------------INGLDGVGEGNDLYPGGQYFDPLGLA 203          
BLAST of BQ623020 vs. ExPASy Swiss-Prot
Match: CB23_PEA (Chlorophyll a-b binding protein 3, chloroplastic OS=Pisum sativum GN=lhca3 PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 4.432e-12
Identity = 50/147 (34.01%), Postives = 75/147 (51.02%), Query Frame = 2
Query:    2 SLPGDYGFDPLGLGKDP----AFL--KWYREAELIHGRWAMAAVVGI----FVGQAW-----SGIPWFEAGADPGAIAPFSFG----SLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPL 385
            SLPGDYGFDPLGL  DP     F+  +W    E+I+GR+AM   VG     ++G+       + + WF+ G  P A   +++     +L   ++ LMG+ E +R+ D+  P S   ++        E     +G   YPGG FF+PL
Sbjct:   71 SLPGDYGFDPLGL-SDPEGTGGFIEPRWLAYGEVINGRFAMLGAVGAIAPEYLGKVGLIPQETALAWFQTGVIPPA-GTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPGSMGKQYFL----GLEKGFGGSGNPAYPGGPFFNPL 211          
The following BLAST results are available for this feature:
BLAST of BQ623020 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
CB4A_SOLLC5.246e-8291.22Chlorophyll a-b binding protein CP24 10A, chloropl... [more]
CB4B_SOLLC6.265e-8089.86Chlorophyll a-b binding protein CP24 10B, chloropl... [more]
CB4_SPIOL8.170e-8089.19Chlorophyll a-b binding protein CP24, chloroplasti... [more]
CB12_PETHY8.910e-2139.55Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB12_SOLLC9.851e-2038.06Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB24_PEA1.858e-1837.59Chlorophyll a-b binding protein P4, chloroplastic ... [more]
CB24_ARATH1.204e-1738.13Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB4B_ARATH4.573e-1330.22Chlorophyll a-b binding protein CP29.2, chloroplas... [more]
CB23_HORVU3.394e-1235.10Chlorophyll a-b binding protein of LHCII type III,... [more]
CB23_PEA4.432e-1234.01Chlorophyll a-b binding protein 3, chloroplastic O... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00111 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00111 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623020 ID=BQ623020|Name=BQ623020|organism=Citrus sinensis|type=EST|length=480bp
TAGTCTCCCAGGTGACTACGGATTCGACCCACTTGGGCTTGGAAAGGACC
CAGCATTCCTGAAATGGTACAGAGAAGCAGAACTGATCCACGGACGATGG
GCAATGGCTGCAGTTGTTGGGATATTCGTCGGACAGGCGTGGAGTGGGAT
TCCATGGTTCGAGGCTGGAGCAGATCCTGGAGCCATAGCACCCTTCTCCT
TCGGCTCACTCCTGGGAACCCAGCTTCTCCTTATGGGTTGGGTTGAGAGC
AAGCGGTGGGTTGATTTTTTCAATCCTGAATCTCAATCAGTTGAATGGGC
AACACCTTGGTCAAGAACTGCTGAAAACTTTGCCAATGCGACTGGTGAAC
AAGGCTACCCTGGTGGAAAGTTTTTTGATCCCTTATGTTTGGCTGGAACA
ATTAAGGATGGTGTCTACATTCCTGACACTGAGAAGCTTGACAGGCCTCA
AAGTTGCTGAGATTAAACATGCTAGGCTTG
back to top