BQ623621
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of BQ623621 vs. ExPASy Swiss-Prot
Match: TPPC1_RAT (Trafficking protein particle complex subunit 1 OS=Rattus norvegicus GN=Trappc1 PE=2 SV=1) HSP 1 Score: 47.3654 bits (111), Expect = 6.272e-11 Identity = 21/37 (56.76%), Postives = 28/37 (75.68%), Query Frame = 3 Query: 111 YTTLYVEYVVKNPLYAPGTPIRSELFNTSLDQYVRTI 221 Y+ LYVE+VVKNPL G ++SELF + LD YVR++ Sbjct: 101 YSALYVEFVVKNPLCPLGQTVQSELFRSRLDSYVRSL 137 HSP 2 Score: 39.6614 bits (91), Expect = 6.272e-11 Identity = 16/39 (41.03%), Postives = 28/39 (71.79%), Query Frame = 2 Query: 2 FRTNTYKLSFMESPSGIKIILVTHPRTGDLRESLKYIYN 118 F+T+ YKL + E+P+GIK+++ T G +R+ L +IY+ Sbjct: 64 FQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHIYS 102
BLAST of BQ623621 vs. ExPASy Swiss-Prot
Match: TPPC1_MOUSE (Trafficking protein particle complex subunit 1 OS=Mus musculus GN=Trappc1 PE=1 SV=1) HSP 1 Score: 47.3654 bits (111), Expect = 6.272e-11 Identity = 21/37 (56.76%), Postives = 28/37 (75.68%), Query Frame = 3 Query: 111 YTTLYVEYVVKNPLYAPGTPIRSELFNTSLDQYVRTI 221 Y+ LYVE+VVKNPL G ++SELF + LD YVR++ Sbjct: 101 YSALYVEFVVKNPLCPLGQTVQSELFRSRLDSYVRSL 137 HSP 2 Score: 39.6614 bits (91), Expect = 6.272e-11 Identity = 16/39 (41.03%), Postives = 28/39 (71.79%), Query Frame = 2 Query: 2 FRTNTYKLSFMESPSGIKIILVTHPRTGDLRESLKYIYN 118 F+T+ YKL + E+P+GIK+++ T G +R+ L +IY+ Sbjct: 64 FQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHIYS 102 The following BLAST results are available for this feature:
BLAST of BQ623621 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ623621 ID=BQ623621; Name=BQ623621; organism=Citrus sinensis; type=EST; length=553bpback to top |