BQ624128
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of BQ624128 vs. ExPASy Swiss-Prot
Match: RL292_ARATH (60S ribosomal protein L29-2 OS=Arabidopsis thaliana GN=RPL29B PE=2 SV=2) HSP 1 Score: 61.2326 bits (147), Expect = 6.967e-18 Identity = 26/29 (89.66%), Postives = 28/29 (96.55%), Query Frame = 3 Query: 24 MAKSKNHTAHNQSYKAHKNGIKKPKKHRH 110 MAKSKNHTAHNQS KAHKNGIKKP++HRH Sbjct: 1 MAKSKNHTAHNQSAKAHKNGIKKPRRHRH 29 HSP 2 Score: 50.0618 bits (118), Expect = 6.967e-18 Identity = 23/39 (58.97%), Postives = 28/39 (71.79%), Query Frame = 1 Query: 88 RNPRSTDTSSTKGMDPKFLRNQRYARKHNKSNGGSAEEE 204 + PR + T+GMDPKFLRNQRYARKHN +G +A E Sbjct: 22 KKPRRHRHTPTRGMDPKFLRNQRYARKHNVKSGENAGVE 60
BLAST of BQ624128 vs. ExPASy Swiss-Prot
Match: RL291_ARATH (60S ribosomal protein L29-1 OS=Arabidopsis thaliana GN=RPL29A PE=1 SV=1) HSP 1 Score: 61.2326 bits (147), Expect = 6.967e-18 Identity = 26/29 (89.66%), Postives = 28/29 (96.55%), Query Frame = 3 Query: 24 MAKSKNHTAHNQSYKAHKNGIKKPKKHRH 110 MAKSKNHTAHNQS KAHKNGIKKP++HRH Sbjct: 1 MAKSKNHTAHNQSAKAHKNGIKKPRRHRH 29 HSP 2 Score: 50.0618 bits (118), Expect = 6.967e-18 Identity = 23/39 (58.97%), Postives = 27/39 (69.23%), Query Frame = 1 Query: 88 RNPRSTDTSSTKGMDPKFLRNQRYARKHNKSNGGSAEEE 204 + PR + T+GMDPKFLRNQRYARKHN G +A E Sbjct: 22 KKPRRHRHTPTRGMDPKFLRNQRYARKHNVKAGENASAE 60
BLAST of BQ624128 vs. ExPASy Swiss-Prot
Match: RL29_PIG (60S ribosomal protein L29 OS=Sus scrofa GN=RPL29 PE=2 SV=4) HSP 1 Score: 49.6766 bits (117), Expect = 5.245e-13 Identity = 21/29 (72.41%), Postives = 24/29 (82.76%), Query Frame = 3 Query: 24 MAKSKNHTAHNQSYKAHKNGIKKPKKHRH 110 MAKSKNHT HNQS K H+NGIKKP+ R+ Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRY 29 HSP 2 Score: 45.0542 bits (105), Expect = 5.245e-13 Identity = 19/30 (63.33%), Postives = 23/30 (76.67%), Query Frame = 1 Query: 88 RNPRSTDTSSTKGMDPKFLRNQRYARKHNK 177 + PRS S KG+DPKFLRN R+A+KHNK Sbjct: 22 KKPRSQRYESLKGVDPKFLRNMRFAKKHNK 51
BLAST of BQ624128 vs. ExPASy Swiss-Prot
Match: RL29_MOUSE (60S ribosomal protein L29 OS=Mus musculus GN=Rpl29 PE=2 SV=2) HSP 1 Score: 49.6766 bits (117), Expect = 5.245e-13 Identity = 21/29 (72.41%), Postives = 24/29 (82.76%), Query Frame = 3 Query: 24 MAKSKNHTAHNQSYKAHKNGIKKPKKHRH 110 MAKSKNHT HNQS K H+NGIKKP+ R+ Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRY 29 HSP 2 Score: 45.0542 bits (105), Expect = 5.245e-13 Identity = 19/30 (63.33%), Postives = 23/30 (76.67%), Query Frame = 1 Query: 88 RNPRSTDTSSTKGMDPKFLRNQRYARKHNK 177 + PRS S KG+DPKFLRN R+A+KHNK Sbjct: 22 KKPRSQRYESLKGVDPKFLRNMRFAKKHNK 51
BLAST of BQ624128 vs. ExPASy Swiss-Prot
Match: RL29_MACFA (60S ribosomal protein L29 OS=Macaca fascicularis GN=RPL29 PE=2 SV=3) HSP 1 Score: 49.6766 bits (117), Expect = 5.252e-13 Identity = 21/29 (72.41%), Postives = 24/29 (82.76%), Query Frame = 3 Query: 24 MAKSKNHTAHNQSYKAHKNGIKKPKKHRH 110 MAKSKNHT HNQS K H+NGIKKP+ R+ Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRY 29 HSP 2 Score: 45.0542 bits (105), Expect = 5.252e-13 Identity = 19/30 (63.33%), Postives = 23/30 (76.67%), Query Frame = 1 Query: 88 RNPRSTDTSSTKGMDPKFLRNQRYARKHNK 177 + PRS S KG+DPKFLRN R+A+KHNK Sbjct: 22 KKPRSQRYESLKGVDPKFLRNMRFAKKHNK 51
BLAST of BQ624128 vs. ExPASy Swiss-Prot
Match: RL29_HUMAN (60S ribosomal protein L29 OS=Homo sapiens GN=RPL29 PE=1 SV=2) HSP 1 Score: 49.6766 bits (117), Expect = 5.252e-13 Identity = 21/29 (72.41%), Postives = 24/29 (82.76%), Query Frame = 3 Query: 24 MAKSKNHTAHNQSYKAHKNGIKKPKKHRH 110 MAKSKNHT HNQS K H+NGIKKP+ R+ Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRY 29 HSP 2 Score: 45.0542 bits (105), Expect = 5.252e-13 Identity = 19/30 (63.33%), Postives = 23/30 (76.67%), Query Frame = 1 Query: 88 RNPRSTDTSSTKGMDPKFLRNQRYARKHNK 177 + PRS S KG+DPKFLRN R+A+KHNK Sbjct: 22 KKPRSQRYESLKGVDPKFLRNMRFAKKHNK 51
BLAST of BQ624128 vs. ExPASy Swiss-Prot
Match: RL29_RAT (60S ribosomal protein L29 OS=Rattus norvegicus GN=Rpl29 PE=1 SV=3) HSP 1 Score: 49.6766 bits (117), Expect = 5.259e-13 Identity = 21/29 (72.41%), Postives = 24/29 (82.76%), Query Frame = 3 Query: 24 MAKSKNHTAHNQSYKAHKNGIKKPKKHRH 110 MAKSKNHT HNQS K H+NGIKKP+ R+ Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRY 29 HSP 2 Score: 45.0542 bits (105), Expect = 5.259e-13 Identity = 19/30 (63.33%), Postives = 23/30 (76.67%), Query Frame = 1 Query: 88 RNPRSTDTSSTKGMDPKFLRNQRYARKHNK 177 + PRS S KG+DPKFLRN R+A+KHNK Sbjct: 22 KKPRSQRYESLKGVDPKFLRNMRFAKKHNK 51
BLAST of BQ624128 vs. ExPASy Swiss-Prot
Match: RL29_BOVIN (60S ribosomal protein L29 OS=Bos taurus GN=RPL29 PE=2 SV=3) HSP 1 Score: 49.6766 bits (117), Expect = 5.267e-13 Identity = 21/29 (72.41%), Postives = 24/29 (82.76%), Query Frame = 3 Query: 24 MAKSKNHTAHNQSYKAHKNGIKKPKKHRH 110 MAKSKNHT HNQS K H+NGIKKP+ R+ Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRY 29 HSP 2 Score: 45.0542 bits (105), Expect = 5.267e-13 Identity = 19/30 (63.33%), Postives = 23/30 (76.67%), Query Frame = 1 Query: 88 RNPRSTDTSSTKGMDPKFLRNQRYARKHNK 177 + PRS S KG+DPKFLRN R+A+KHNK Sbjct: 22 KKPRSQRYESLKGVDPKFLRNMRFAKKHNK 51 The following BLAST results are available for this feature:
BLAST of BQ624128 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 8
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ624128 ID=BQ624128; Name=BQ624128; organism=Citrus sinensis; type=EST; length=479bpback to top |