CB250297

Overview
NameCB250297
Unique NameCB250297
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length263
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2282 contig Csv1_Contig2282:314..576. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250297 vs. ExPASy Swiss-Prot
Match: GH33_ARATH (Indole-3-acetic acid-amido synthetase GH3.3 OS=Arabidopsis thaliana GN=GH3.3 PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 8.046e-37
Identity = 73/87 (83.91%), Postives = 79/87 (90.80%), Query Frame = 3
Query:    3 TSYADTTTIPGHYVIFWELLVKDAANSPSDEVLNQCCLVVEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAISRGASINQ 263
            TSYA+T TIPGHYVI+WELLVKD  N P+DEV+ +CCL +EESLNSVYRQ RVAD SIGPLEIRVVKNGTFEELMDYAISRGASINQ
Sbjct:  471 TSYAETKTIPGHYVIYWELLVKDQTNPPNDEVMARCCLEMEESLNSVYRQSRVADKSIGPLEIRVVKNGTFEELMDYAISRGASINQ 557          
BLAST of CB250297 vs. ExPASy Swiss-Prot
Match: GH31_ARATH (Probable indole-3-acetic acid-amido synthetase GH3.1 OS=Arabidopsis thaliana GN=GH3.1 PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 1.373e-36
Identity = 71/87 (81.61%), Postives = 79/87 (90.80%), Query Frame = 3
Query:    3 TSYADTTTIPGHYVIFWELLVKDAANSPSDEVLNQCCLVVEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAISRGASINQ 263
            TSYADT+TIPGHYV++WELLV+D A  PS E L +CCL +EESLNSVYRQ RVADNS+GPLEIRVV+NGTFEELMDYAISRGASINQ
Sbjct:  465 TSYADTSTIPGHYVLYWELLVRDGARQPSHETLTRCCLGMEESLNSVYRQSRVADNSVGPLEIRVVRNGTFEELMDYAISRGASINQ 551          
BLAST of CB250297 vs. ExPASy Swiss-Prot
Match: GH34_ARATH (Indole-3-acetic acid-amido synthetase GH3.4 OS=Arabidopsis thaliana GN=GH3.4 PE=1 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 3.164e-33
Identity = 67/88 (76.14%), Postives = 80/88 (90.91%), Query Frame = 3
Query:    3 TSYADTTTIPGHYVIFWELLVKDAANS-PSDEVLNQCCLVVEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAISRGASINQ 263
            TSYADT TIPGHYVI+WELL +D +N+ PSDEV+ +CCL +EESLN+VYRQ RV+D SIGPLEIRVV+NGTFEELMD++ISRG+SINQ
Sbjct:  472 TSYADTKTIPGHYVIYWELLSRDQSNALPSDEVMAKCCLEMEESLNAVYRQSRVSDKSIGPLEIRVVQNGTFEELMDFSISRGSSINQ 559          
BLAST of CB250297 vs. ExPASy Swiss-Prot
Match: GH38_ORYSJ (Probable indole-3-acetic acid-amido synthetase GH3.8 OS=Oryza sativa subsp. japonica GN=GH3.8 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 4.003e-28
Identity = 63/88 (71.59%), Postives = 71/88 (80.68%), Query Frame = 3
Query:    3 TSYADTTTIPGHYVIFWELLVKDAANSPSD-EVLNQCCLVVEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAISRGASINQ 263
            TS A T  IPGHYVI+WELL K A  +  D + L +CCL +EE+LN+VYRQ RVAD SIGPLEIRVV+ GTFEELMDYAISRGASINQ
Sbjct:  479 TSQACTKRIPGHYVIYWELLTKGAGATVVDADTLGRCCLEMEEALNTVYRQSRVADGSIGPLEIRVVRPGTFEELMDYAISRGASINQ 566          
BLAST of CB250297 vs. ExPASy Swiss-Prot
Match: GH38_ORYSI (Probable indole-3-acetic acid-amido synthetase GH3.8 OS=Oryza sativa subsp. indica GN=GH3.8 PE=2 SV=2)

HSP 1 Score: 123.25 bits (308), Expect = 4.003e-28
Identity = 63/88 (71.59%), Postives = 71/88 (80.68%), Query Frame = 3
Query:    3 TSYADTTTIPGHYVIFWELLVKDAANSPSD-EVLNQCCLVVEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAISRGASINQ 263
            TS A T  IPGHYVI+WELL K A  +  D + L +CCL +EE+LN+VYRQ RVAD SIGPLEIRVV+ GTFEELMDYAISRGASINQ
Sbjct:  479 TSQACTKRIPGHYVIYWELLTKGAGATVVDADTLGRCCLEMEEALNTVYRQSRVADGSIGPLEIRVVRPGTFEELMDYAISRGASINQ 566          
BLAST of CB250297 vs. ExPASy Swiss-Prot
Match: GH36_ARATH (Indole-3-acetic acid-amido synthetase GH3.6 OS=Arabidopsis thaliana GN=GH3.6 PE=1 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 4.003e-28
Identity = 59/87 (67.82%), Postives = 71/87 (81.61%), Query Frame = 3
Query:    3 TSYADTTTIPGHYVIFWELLVKDAANSPSDEVLNQCCLVVEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAISRGASINQ 263
            TSYADT++IPGHYV+FWEL +      P   V   CCL +EESLNSVYRQGRV+D SIGPLEI++V++GTF++LMDYAIS GASINQ
Sbjct:  485 TSYADTSSIPGHYVLFWELCLNGNTPIPPS-VFEDCCLTIEESLNSVYRQGRVSDKSIGPLEIKMVESGTFDKLMDYAISLGASINQ 570          
BLAST of CB250297 vs. ExPASy Swiss-Prot
Match: GH31_ORYSJ (Probable indole-3-acetic acid-amido synthetase GH3.1 OS=Oryza sativa subsp. japonica GN=GH3.1 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 4.003e-28
Identity = 62/87 (71.26%), Postives = 67/87 (77.01%), Query Frame = 3
Query:    3 TSYADTTTIPGHYVIFWELLVKDAANSPSDEVLNQCCLVVEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAISRGASINQ 263
            TSYAD  TIPGHYV+FWEL     A   S  V  +CCL VEE+LNSVYRQGR  D SIGPLEIRVV  GTF++LMDYAISRGASINQ
Sbjct:  475 TSYADAATIPGHYVLFWELRAGSTAVPAS--VFEECCLSVEEALNSVYRQGRACDRSIGPLEIRVVAEGTFDKLMDYAISRGASINQ 559          
BLAST of CB250297 vs. ExPASy Swiss-Prot
Match: GH35_ARATH (Indole-3-acetic acid-amido synthetase GH3.5 OS=Arabidopsis thaliana GN=GH3.5 PE=1 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 3.388e-27
Identity = 58/87 (66.67%), Postives = 69/87 (79.31%), Query Frame = 3
Query:    3 TSYADTTTIPGHYVIFWELLVKDAANSPSDEVLNQCCLVVEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAISRGASINQ 263
            TSYADT++IPGHYV+FWEL +      P   V   CCL VEES N+VYRQGRV+D SIGPLEI++V+ GTF++LMDYAIS GASINQ
Sbjct:  485 TSYADTSSIPGHYVLFWELCLDGNTPIPPS-VFEDCCLAVEESFNTVYRQGRVSDKSIGPLEIKIVEPGTFDKLMDYAISLGASINQ 570          
BLAST of CB250297 vs. ExPASy Swiss-Prot
Match: GH34_ORYSJ (Probable indole-3-acetic acid-amido synthetase GH3.4 OS=Oryza sativa subsp. japonica GN=GH3.4 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 3.388e-27
Identity = 61/88 (69.32%), Postives = 66/88 (75.00%), Query Frame = 3
Query:    3 TSYADT-TTIPGHYVIFWELLVKDAANSPSDEVLNQCCLVVEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAISRGASINQ 263
            TSYADT TTIPGHYV+FWEL            V   CCL VEE LNSVYRQ R AD SIGPLEIRVV +GTF++LMDYA+SRGASINQ
Sbjct:  483 TSYADTATTIPGHYVLFWELRSPAGGTPVPASVFEDCCLAVEEGLNSVYRQCRAADRSIGPLEIRVVADGTFDKLMDYALSRGASINQ 570          
BLAST of CB250297 vs. ExPASy Swiss-Prot
Match: GH32_ORYSJ (Probable indole-3-acetic acid-amido synthetase GH3.2 OS=Oryza sativa subsp. japonica GN=GH3.2 PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 8.346e-26
Identity = 60/93 (64.52%), Postives = 75/93 (80.65%), Query Frame = 3
Query:    3 TSYADTTTIPGHYVIFWELLVKD--AANSPSDE----VLNQCCLVVEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAISRGASINQ 263
            TS AD TTIPGHYV++WEL+V++  A   P++E    V  +CCL +EE+LN+VYRQGR  + +IGPLEIRVV+ GTFEE+MDYAISRGASINQ
Sbjct:  486 TSQADATTIPGHYVVYWELMVREGGAWPPPAEEEGRGVFERCCLEMEEALNAVYRQGRNGE-AIGPLEIRVVRAGTFEEVMDYAISRGASINQ 577          
The following BLAST results are available for this feature:
BLAST of CB250297 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 17
Match NameE-valueIdentityDescription
GH33_ARATH8.046e-3783.91Indole-3-acetic acid-amido synthetase GH3.3 OS=Ara... [more]
GH31_ARATH1.373e-3681.61Probable indole-3-acetic acid-amido synthetase GH3... [more]
GH34_ARATH3.164e-3376.14Indole-3-acetic acid-amido synthetase GH3.4 OS=Ara... [more]
GH38_ORYSJ4.003e-2871.59Probable indole-3-acetic acid-amido synthetase GH3... [more]
GH38_ORYSI4.003e-2871.59Probable indole-3-acetic acid-amido synthetase GH3... [more]
GH36_ARATH4.003e-2867.82Indole-3-acetic acid-amido synthetase GH3.6 OS=Ara... [more]
GH31_ORYSJ4.003e-2871.26Probable indole-3-acetic acid-amido synthetase GH3... [more]
GH35_ARATH3.388e-2766.67Indole-3-acetic acid-amido synthetase GH3.5 OS=Ara... [more]
GH34_ORYSJ3.388e-2769.32Probable indole-3-acetic acid-amido synthetase GH3... [more]
GH32_ORYSJ8.346e-2664.52Probable indole-3-acetic acid-amido synthetase GH3... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0076 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ102 similar to Nt-gh3 protein (acc# AAD32141), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250297 ID=CB250297|Name=CB250297|organism=Citrus sinensis|type=EST|length=263bp
ACACAAGTTATGCTGACACAACGACAATTCCAGGACATTATGTGATATTC
TGGGAGTTGCTTGTTAAAGATGCAGCCAATTCACCAAGTGATGAGGTGCT
GAATCAATGTTGCCTGGTAGTGGAAGAGTCGCTGAACTCGGTGTATCGAC
AAGGCCGAGTTGCTGATAATTCAATTGGACCACTAGAGATAAGGGTGGTG
AAAAATGGGACATTTGAGGAGCTAATGGACTATGCCATTTCACGGGGCGC
GTCAATTAATCAG
back to top