CB304514

Overview
NameCB304514
Unique NameCB304514
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4200 contig Csv1_Contig4200:340..943. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304514 vs. ExPASy Swiss-Prot
Match: R10A3_ARATH (60S ribosomal protein L10a-3 OS=Arabidopsis thaliana GN=RPL10AC PE=2 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 2.477e-55
Identity = 106/111 (95.50%), Postives = 110/111 (99.10%), Query Frame = -2
Query:  211 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQKSLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPSNRIF 543
            +HAFLASESVIKQIPRLLGPGLNKAGKFPTLV+HQ+SLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGP NR+F
Sbjct:  107 FHAFLASESVIKQIPRLLGPGLNKAGKFPTLVSHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPPNRVF 217          
BLAST of CB304514 vs. ExPASy Swiss-Prot
Match: R10A1_ARATH (60S ribosomal protein L10a-1 OS=Arabidopsis thaliana GN=RPL10AA PE=2 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 3.235e-55
Identity = 107/111 (96.40%), Postives = 109/111 (98.20%), Query Frame = -2
Query:  211 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQKSLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPSNRIF 543
            YHAFLASESVIKQIPRLLGPGLNKAGKFPTLV+HQ+SLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGP  RIF
Sbjct:  106 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVSHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPPQRIF 216          
BLAST of CB304514 vs. ExPASy Swiss-Prot
Match: R10A2_ARATH (60S ribosomal protein L10a-2 OS=Arabidopsis thaliana GN=RPL10AB PE=2 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 1.229e-54
Identity = 105/111 (94.59%), Postives = 109/111 (98.20%), Query Frame = -2
Query:  211 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQKSLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPSNRIF 543
            YHAFLASESVIKQIPRLLGPGLNKAGKFPTLV+HQ+SLE+KVNETKATVKFQLKKVLCMGVAVGNLSMEEKQ+FQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGP  RIF
Sbjct:  106 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVSHQESLEAKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQLFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPPQRIF 216          
BLAST of CB304514 vs. ExPASy Swiss-Prot
Match: RL10A_DANRE (60S ribosomal protein L10a OS=Danio rerio GN=rpl10a PE=2 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.459e-39
Identity = 74/111 (66.67%), Postives = 97/111 (87.39%), Query Frame = -2
Query:  211 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQKSLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPSNRIF 543
            Y AFLASES+IKQIPR+LGPGLNKAGKFP+L+TH ++L +KV+E K+T+KFQ+KKVLC+ VAVG++ M E+++  N+ ++VNFLVSLLKKNWQNVR LY+KSTMG   R++
Sbjct:  106 YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENLGTKVDEVKSTIKFQMKKVLCLAVAVGHVKMSEEELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQRLY 216          
BLAST of CB304514 vs. ExPASy Swiss-Prot
Match: RL10A_XENLA (60S ribosomal protein L10a OS=Xenopus laevis GN=rpl10a PE=2 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 2.489e-39
Identity = 73/111 (65.77%), Postives = 97/111 (87.39%), Query Frame = -2
Query:  211 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQKSLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPSNRIF 543
            Y AFLASES+IKQIPR+LGPGLNKAGKFP+L+TH ++L +KV+E K+T+KFQ+KKVLC+ VAVG++ + E+++  N+ +S+NFLVSLLKKNWQNVR LY+KSTMG   R++
Sbjct:  107 YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENLVAKVDEVKSTIKFQMKKVLCLAVAVGHVKLTEEELVYNIHLSINFLVSLLKKNWQNVRALYIKSTMGKPQRLY 217          
BLAST of CB304514 vs. ExPASy Swiss-Prot
Match: R10AB_DROME (60S ribosomal protein L10a-2 OS=Drosophila melanogaster GN=RpL10Ab PE=1 SV=2)

HSP 1 Score: 161.77 bits (408), Expect = 2.489e-39
Identity = 74/111 (66.67%), Postives = 96/111 (86.49%), Query Frame = -2
Query:  211 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQKSLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPSNRIF 543
            Y AFLASES+IKQIPRLLGPGLNKAGKFP L++HQ+S+  K+ E K+T+KFQ+KKVLC+ VAVG++ M+  ++ QNV +S+NFLVSLLKKNWQNVR L++KS+MGP  R++
Sbjct:  107 YDAFLASESLIKQIPRLLGPGLNKAGKFPALLSHQESMIGKIEEVKSTIKFQMKKVLCLSVAVGHVGMKSDELAQNVNLSINFLVSLLKKNWQNVRSLHVKSSMGPPQRLY 217          
BLAST of CB304514 vs. ExPASy Swiss-Prot
Match: RL10A_ICTPU (60S ribosomal protein L10a OS=Ictalurus punctatus GN=rpl10a PE=2 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 5.544e-39
Identity = 73/111 (65.77%), Postives = 96/111 (86.49%), Query Frame = -2
Query:  211 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQKSLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPSNRIF 543
            Y AFLASES+IKQIPR+LGPGLNKAGKFP+L+TH ++L +KV+E K+T+KFQ+KKVLC+ VAVG++ M E ++  N+ ++VNFLVSLLKKNWQNVR LY+KS+MG   R++
Sbjct:  106 YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENLNTKVDEVKSTIKFQMKKVLCLAVAVGHVRMSEDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSSMGKPQRLY 216          
BLAST of CB304514 vs. ExPASy Swiss-Prot
Match: RL10A_SPOFR (60S ribosomal protein L10a OS=Spodoptera frugiperda GN=RpL10A PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 7.241e-39
Identity = 74/111 (66.67%), Postives = 96/111 (86.49%), Query Frame = -2
Query:  211 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQKSLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPSNRIF 543
            Y AFLASES+IKQIPRLLGPGLNKAGKFP L++HQ+S+  K++E KAT+KFQ+KKVLC+ VAVG++ M   ++ QNV +S+NFLVSLLKK+WQNVR L++KSTMGP  +++
Sbjct:  107 YDAFLASESLIKQIPRLLGPGLNKAGKFPGLLSHQESMTQKIDEVKATIKFQMKKVLCLSVAVGHVDMTPDELAQNVHLSINFLVSLLKKHWQNVRSLHMKSTMGPPPKLY 217          
BLAST of CB304514 vs. ExPASy Swiss-Prot
Match: RL10A_RAT (60S ribosomal protein L10a OS=Rattus norvegicus GN=Rpl10a PE=1 SV=2)

HSP 1 Score: 159.458 bits (402), Expect = 1.235e-38
Identity = 72/111 (64.86%), Postives = 96/111 (86.49%), Query Frame = -2
Query:  211 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQKSLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPSNRIF 543
            Y AFLASES+IKQIPR+LGPGLNKAGKFP+L+TH +++ +KV+E K+T+KFQ+KKVLC+ VAVG++ M + ++  N+ ++VNFLVSLLKKNWQNVR LY+KSTMG   R++
Sbjct:  107 YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQRLY 217          
BLAST of CB304514 vs. ExPASy Swiss-Prot
Match: RL10A_MOUSE (60S ribosomal protein L10a OS=Mus musculus GN=Rpl10a PE=1 SV=3)

HSP 1 Score: 159.458 bits (402), Expect = 1.235e-38
Identity = 72/111 (64.86%), Postives = 96/111 (86.49%), Query Frame = -2
Query:  211 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQKSLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPSNRIF 543
            Y AFLASES+IKQIPR+LGPGLNKAGKFP+L+TH +++ +KV+E K+T+KFQ+KKVLC+ VAVG++ M + ++  N+ ++VNFLVSLLKKNWQNVR LY+KSTMG   R++
Sbjct:  107 YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQRLY 217          
The following BLAST results are available for this feature:
BLAST of CB304514 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 28
Match NameE-valueIdentityDescription
R10A3_ARATH2.477e-5595.5060S ribosomal protein L10a-3 OS=Arabidopsis thalia... [more]
R10A1_ARATH3.235e-5596.4060S ribosomal protein L10a-1 OS=Arabidopsis thalia... [more]
R10A2_ARATH1.229e-5494.5960S ribosomal protein L10a-2 OS=Arabidopsis thalia... [more]
RL10A_DANRE1.459e-3966.6760S ribosomal protein L10a OS=Danio rerio GN=rpl10... [more]
RL10A_XENLA2.489e-3965.7760S ribosomal protein L10a OS=Xenopus laevis GN=rp... [more]
R10AB_DROME2.489e-3966.6760S ribosomal protein L10a-2 OS=Drosophila melanog... [more]
RL10A_ICTPU5.544e-3965.7760S ribosomal protein L10a OS=Ictalurus punctatus ... [more]
RL10A_SPOFR7.241e-3966.6760S ribosomal protein L10a OS=Spodoptera frugiperd... [more]
RL10A_RAT1.235e-3864.8660S ribosomal protein L10a OS=Rattus norvegicus GN... [more]
RL10A_MOUSE1.235e-3864.8660S ribosomal protein L10a OS=Mus musculus GN=Rpl1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IIaR_H11 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IIaR_H11 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304514 ID=CB304514|Name=CB304514|organism=Citrus sinensis|type=EST|length=604bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGCAAAAAAATTCGTACAAGT
CTACCATATTATAAGATTACTAGTGCATTAAATTCAGAAAAGAAAAAGAA
AAAGAAAAAGAAAATTGCAGGTTGTGACCATTCAAAGAAAGACATTTTGG
GTATAATAAGATCACACTAGGTTTTCCCTACAAAACTCCAACATAAAGCA
GAATTTCTTAAAAGATGCGGTTTGAAGGACCCATGGTACTCTTCAGATAG
AGGCACCTGACATTCTGCCAGTTTTTCTTCAACAATGAGACAAGGAAGTT
AACACTCATTTGAACATTCTGGAAGATCTGCTTCTCCTCCATTGAAAGGT
TTCCAACAGCAACTCCCATGCAAAGCACCTTCTTCAATTGGAACTTCACT
GTTGCCTTAGTCTCGTTGACTTTGGACTCCAGGGATTTTTGGTGAGTAAC
AAGGGTAGGGAACTTTCCTGCCTTGTTGAGACCAGGACCCAACAAACGAG
GAATCTGCTTGATGACAGACTCTGATGCCAAGAAAGCATGATATTTCTTG
GCAAGTTTCTTCACCAATTTCTTGTTCTTGTTCAATTTTTCAATCCTTCA
CATC
back to top