CB304579
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CB304579 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSJ (Hydrophobic protein LTI6B OS=Oryza sativa subsp. japonica GN=LTI6B PE=2 SV=1) HSP 1 Score: 97.4413 bits (241), Expect = 5.145e-20 Identity = 43/52 (82.69%), Postives = 47/52 (90.38%), Query Frame = -2 Query: 328 TATCVDIFLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 483 TA C+DI +A+ILPPLGVFLKFGC EFWICLLLT LGYIPGIIYA+YAITK Sbjct: 4 TANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55
BLAST of CB304579 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSI (Hydrophobic protein LTI6B OS=Oryza sativa subsp. indica GN=LTI6B PE=3 SV=2) HSP 1 Score: 97.4413 bits (241), Expect = 5.145e-20 Identity = 43/52 (82.69%), Postives = 47/52 (90.38%), Query Frame = -2 Query: 328 TATCVDIFLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 483 TA C+DI +A+ILPPLGVFLKFGC EFWICLLLT LGYIPGIIYA+YAITK Sbjct: 4 TANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55
BLAST of CB304579 vs. ExPASy Swiss-Prot
Match: LTI6A_ORYSJ (Hydrophobic protein LTI6A OS=Oryza sativa subsp. japonica GN=LTI6A PE=2 SV=1) HSP 1 Score: 96.2857 bits (238), Expect = 1.146e-19 Identity = 45/57 (78.95%), Postives = 49/57 (85.96%), Query Frame = -2 Query: 328 MADGSTATCVDIFLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 498 MAD STATC+DI LA+ILPPLGVF KFGC EFWICLLLT GY+PGIIYAV+ ITK Sbjct: 1 MAD-STATCIDIILAIILPPLGVFFKFGCGIEFWICLLLTFFGYLPGIIYAVWVITK 56
BLAST of CB304579 vs. ExPASy Swiss-Prot
Match: RCI2B_ARATH (Hydrophobic protein RCI2B OS=Arabidopsis thaliana GN=RCI2B PE=2 SV=1) HSP 1 Score: 93.9745 bits (232), Expect = 5.688e-19 Identity = 41/53 (77.36%), Postives = 48/53 (90.57%), Query Frame = -2 Query: 328 STATCVDIFLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 486 STAT V+I LA+ILPPLGVFLKFGCK EFWICL+LT+ GY+PGI+YA+Y ITK Sbjct: 2 STATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54
BLAST of CB304579 vs. ExPASy Swiss-Prot
Match: RCI2A_ARATH (Hydrophobic protein RCI2A OS=Arabidopsis thaliana GN=RCI2A PE=2 SV=1) HSP 1 Score: 93.2041 bits (230), Expect = 9.703e-19 Identity = 40/53 (75.47%), Postives = 48/53 (90.57%), Query Frame = -2 Query: 328 STATCVDIFLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 486 STAT VDI +A++LPPLGVFL+FGC EFWICL+LT+LGYIPGIIYA+Y +TK Sbjct: 2 STATFVDIIIAILLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54
BLAST of CB304579 vs. ExPASy Swiss-Prot
Match: LT02_HORVU (Low temperature-induced protein lt101.2 OS=Hordeum vulgare GN=LT101.2 PE=2 SV=1) HSP 1 Score: 81.6481 bits (200), Expect = 2.921e-15 Identity = 34/51 (66.67%), Postives = 45/51 (88.24%), Query Frame = -2 Query: 334 STATCVDIFLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAI 486 ++AT +++ LA+ILPP+GVFL++G EFWICLLLT+LGYIPGIIYAVY + Sbjct: 2 ASATFIEVILAIILPPVGVFLRYGLAVEFWICLLLTLLGYIPGIIYAVYVL 52
BLAST of CB304579 vs. ExPASy Swiss-Prot
Match: OSR8_ORYSJ (Hydrophobic protein OSR8 OS=Oryza sativa subsp. japonica GN=OSR8 PE=3 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 4.983e-15 Identity = 39/56 (69.64%), Postives = 45/56 (80.36%), Query Frame = -2 Query: 334 MADGSTATCVDIFLAVILPPLGVFLKFGC-KAEFWICLLLTILGYIPGIIYAVYAI 498 MA G T ++I LA+ILPPLGVFL+FGC EF ICLLLTILGY+PGIIYAVY + Sbjct: 1 MASGRCCTFLEILLAIILPPLGVFLRFGCCSMEFCICLLLTILGYVPGIIYAVYVL 56
BLAST of CB304579 vs. ExPASy Swiss-Prot
Match: LT01_HORVU (Low temperature-induced protein lt101.1 OS=Hordeum vulgare GN=LT101.1 PE=2 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 3.230e-14 Identity = 34/50 (68.00%), Postives = 43/50 (86.00%), Query Frame = -2 Query: 334 TATCVDIFLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAI 483 +AT +++ LA+ILPP+GVFL++ EFWICLLLTILGYIPGIIYAVY + Sbjct: 3 SATVLEVILAIILPPVGVFLRYKLGVEFWICLLLTILGYIPGIIYAVYVL 52
BLAST of CB304579 vs. ExPASy Swiss-Prot
Match: ESI3_LOPEL (Salt stress-induced hydrophobic peptide ESI3 OS=Lophopyrum elongatum GN=ESI3 PE=2 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 3.230e-14 Identity = 34/50 (68.00%), Postives = 43/50 (86.00%), Query Frame = -2 Query: 334 TATCVDIFLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAI 483 +AT +++ LA+ILPP+GVFL++ EFWICLLLTILGYIPGIIYAVY + Sbjct: 3 SATVLEVILAIILPPVGVFLRYKLGVEFWICLLLTILGYIPGIIYAVYVL 52
BLAST of CB304579 vs. ExPASy Swiss-Prot
Match: PMP3_DEBHA (Plasma membrane proteolipid 3 OS=Debaryomyces hansenii GN=PMP3 PE=3 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 6.092e-13 Identity = 35/53 (66.04%), Postives = 43/53 (81.13%), Query Frame = -2 Query: 328 TCVDIF---LAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 477 TC DIF +A+ILPPLGVFL+ GC + FWI ++LTILGYIPGII+A+Y I K Sbjct: 4 TCSDIFKIIIAIILPPLGVFLERGCASSFWINIVLTILGYIPGIIHALYVILK 56 The following BLAST results are available for this feature:
BLAST of CB304579 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 16
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CB304579 ID=CB304579; Name=CB304579; organism=Citrus sinensis; type=EST; length=571bpback to top |