CB304780
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB304780 vs. ExPASy Swiss-Prot
Match: CYSZ_CUCMA (Citrate synthase, glyoxysomal OS=Cucurbita maxima PE=1 SV=1) HSP 1 Score: 97.4413 bits (241), Expect = 3.502e-20 Identity = 44/58 (75.86%), Postives = 52/58 (89.66%), Query Frame = -1 Query: 315 RESLDDPDTKIMRPQQVYTGVWMRHYMPLKERMIEKNADRLGQVSVSNATRRRLAGSG 488 RESLDDPDTKI+RPQQVYTG W+RHY+P ER++ ADRLGQVSVSNA++RRL+GSG Sbjct: 458 RESLDDPDTKIIRPQQVYTGEWLRHYIPPNERLVPAKADRLGQVSVSNASKRRLSGSG 515
BLAST of CB304780 vs. ExPASy Swiss-Prot
Match: CISY3_ARATH (Citrate synthase 3, peroxisomal OS=Arabidopsis thaliana GN=CSY3 PE=1 SV=1) HSP 1 Score: 93.5893 bits (231), Expect = 5.056e-19 Identity = 43/60 (71.67%), Postives = 53/60 (88.33%), Query Frame = -1 Query: 318 RESLDDPDTKIMRPQQVYTGVWMRHYMPLKERMI---EKNADRLGQVSVSNATRRRLAGS 488 +ESLDDPDTKIMRPQQVYTGVW+RHY P++ER++ K +D+LGQV+ SNA+RRRLAGS Sbjct: 448 KESLDDPDTKIMRPQQVYTGVWLRHYTPVRERIVTDDSKESDKLGQVATSNASRRRLAGS 507
BLAST of CB304780 vs. ExPASy Swiss-Prot
Match: CISY2_ARATH (Citrate synthase 2, peroxisomal OS=Arabidopsis thaliana GN=CSY2 PE=2 SV=1) HSP 1 Score: 91.2781 bits (225), Expect = 2.509e-18 Identity = 42/59 (71.19%), Postives = 51/59 (86.44%), Query Frame = -1 Query: 318 RESLDDPDTKIMRPQQVYTGVWMRHYMPLKERMI--EKNADRLGQVSVSNATRRRLAGS 488 RESLDDPDT+IMRPQQ YTGVWMRHY P++ER + + + D+ GQVS+SNA+RRRLAGS Sbjct: 453 RESLDDPDTRIMRPQQAYTGVWMRHYEPVRERTLSSDSDKDKFGQVSISNASRRRLAGS 511 The following BLAST results are available for this feature:
BLAST of CB304780 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CB304780 ID=CB304780; Name=CB304780; organism=Citrus sinensis; type=EST; length=488bpback to top |