CB610494
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB610494 vs. ExPASy Swiss-Prot
Match: GPX4_CITSI (Probable phospholipid hydroperoxide glutathione peroxidase OS=Citrus sinensis GN=CSA PE=1 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 5.454e-14 Identity = 36/38 (94.74%), Postives = 36/38 (94.74%), Query Frame = 2 Query: 5 KWNFPKFLVDKEGNVXERYAPTTSPLSIEKDIKKLLET 118 KWNF KFLVDKEGNV ERYAPTTSPLSIEKDIKKLLET Sbjct: 129 KWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLLET 166
BLAST of CB610494 vs. ExPASy Swiss-Prot
Match: GPX6_ARATH (Probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial OS=Arabidopsis thaliana GN=GPX6 PE=2 SV=2) HSP 1 Score: 68.1662 bits (165), Expect = 1.485e-11 Identity = 30/36 (83.33%), Postives = 34/36 (94.44%), Query Frame = 2 Query: 5 KWNFPKFLVDKEGNVXERYAPTTSPLSIEKDIKKLL 112 KWNF KFLVDK+GNV +R+APTTSPLSIEKD+KKLL Sbjct: 193 KWNFAKFLVDKDGNVVDRFAPTTSPLSIEKDVKKLL 228
BLAST of CB610494 vs. ExPASy Swiss-Prot
Match: GPX4_HELAN (Probable phospholipid hydroperoxide glutathione peroxidase OS=Helianthus annuus GN=GPXHA-2 PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 1.940e-11 Identity = 31/36 (86.11%), Postives = 33/36 (91.67%), Query Frame = 2 Query: 5 KWNFPKFLVDKEGNVXERYAPTTSPLSIEKDIKKLL 112 KWNF KFLVD+EG V +RYAPTTSPLSIEKDIKKLL Sbjct: 142 KWNFTKFLVDREGKVVDRYAPTTSPLSIEKDIKKLL 177
BLAST of CB610494 vs. ExPASy Swiss-Prot
Match: GPX4_SPIOL (Probable phospholipid hydroperoxide glutathione peroxidase OS=Spinacia oleracea PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.533e-11 Identity = 30/36 (83.33%), Postives = 33/36 (91.67%), Query Frame = 2 Query: 5 KWNFPKFLVDKEGNVXERYAPTTSPLSIEKDIKKLL 112 KWNF KFLVDK+GNV +RYAPTTSP SIEKD+KKLL Sbjct: 132 KWNFTKFLVDKDGNVVDRYAPTTSPKSIEKDVKKLL 167
BLAST of CB610494 vs. ExPASy Swiss-Prot
Match: GPX4_TOBAC (Probable phospholipid hydroperoxide glutathione peroxidase OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.371e-11 Identity = 29/36 (80.56%), Postives = 33/36 (91.67%), Query Frame = 2 Query: 5 KWNFPKFLVDKEGNVXERYAPTTSPLSIEKDIKKLL 112 KWNF KFLVDKEGNV +RY+PTT+P S+EKDIKKLL Sbjct: 131 KWNFSKFLVDKEGNVVDRYSPTTTPASMEKDIKKLL 166
BLAST of CB610494 vs. ExPASy Swiss-Prot
Match: GPX4_NICSY (Probable phospholipid hydroperoxide glutathione peroxidase OS=Nicotiana sylvestris PE=2 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.371e-11 Identity = 29/36 (80.56%), Postives = 33/36 (91.67%), Query Frame = 2 Query: 5 KWNFPKFLVDKEGNVXERYAPTTSPLSIEKDIKKLL 112 KWNF KFLVDKEGNV +RY+PTT+P S+EKDIKKLL Sbjct: 131 KWNFSKFLVDKEGNVVDRYSPTTTPASMEKDIKKLL 166
BLAST of CB610494 vs. ExPASy Swiss-Prot
Match: GPX4_GOSHI (Probable phospholipid hydroperoxide glutathione peroxidase OS=Gossypium hirsutum PE=2 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.371e-11 Identity = 29/36 (80.56%), Postives = 33/36 (91.67%), Query Frame = 2 Query: 5 KWNFPKFLVDKEGNVXERYAPTTSPLSIEKDIKKLL 112 KWNF KFLVDKEGNV +RY+PTT+P S+EKDIKKLL Sbjct: 132 KWNFSKFLVDKEGNVVDRYSPTTTPASMEKDIKKLL 167 The following BLAST results are available for this feature:
BLAST of CB610494 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 7
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CB610494 ID=CB610494; Name=CB610494; organism=Citrus sinensis; type=EST; length=401bpback to top |