CF504032

Overview
NameCF504032
Unique NameCF504032
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length549
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF504032_ssr223 microsatellite CF504032_ssr223:223..234. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig13371 contig Csv1_Contig13371:120..669. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF504032 vs. ExPASy Swiss-Prot
Match: RR17_ARATH (30S ribosomal protein S17, chloroplastic OS=Arabidopsis thaliana GN=RPS17 PE=1 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 6.748e-35
Identity = 83/142 (58.45%), Postives = 99/142 (69.72%), Query Frame = 1
Query:    1 KLSSPKTRFLNGSTPLTRLSKPPSTPQNLPYSSFPQIKAMKKMQGRVVCASSDKTVAVEVVRLDPHPXXXXXXXXXXXXQAHDPENQFQVGDLVQLEKSRPISKTKSFIAVAMPPRNASKKAAGESSNAGNNELGIPSESEQ 426
            KLSSP   F +GSTPL+ LSKP S P +   +  P I+AMK MQGRVVCA+SDKTVAVEVVRL PHP            QAHDP+NQF+VGD+V+LEKSRPISKTKSF+A+ +  R A K  AG     G+  LG+P ES+Q
Sbjct:   14 KLSSP---FAHGSTPLSSLSKPNSFPNHRMPALVPVIRAMKTMQGRVVCATSDKTVAVEVVRLAPHPKYKRRVRMKKKYQAHDPDNQFKVGDVVRLEKSRPISKTKSFVALPVIARAARKAEAG-----GDELLGLPLESQQ 147          
BLAST of CF504032 vs. ExPASy Swiss-Prot
Match: RR17_PEA (30S ribosomal protein S17, chloroplastic (Fragment) OS=Pisum sativum GN=RPS17 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 7.990e-28
Identity = 71/138 (51.45%), Postives = 85/138 (61.59%), Query Frame = 1
Query:   25 FLNGSTPLTRLSKPPSTPQNLPYSS---FPQIKAMKKMQGRVVCASSDKTVAVEVVRLDPHPXXXXXXXXXXXXQAHDPENQFQVGDLVQLEKSRPISKTKSFIAVAMPPRNASKKAAGESSNAGNNELGIPSESEQQ 429
            F      L R S P S+PQ    +    FP IKAMK M+G+VVCAS +KTVAVEV RL PHP            QAHDPEN F+VGD+VQL K+RPISK K+F+AV  P R + K  AG S      ELGIP +S+Q+
Sbjct:    4 FTGNGIGLNRFSNPISSPQTQTQTRSLPFPAIKAMKTMEGKVVCASGNKTVAVEVTRLAPHPKYQKRIRLKKKYQAHDPENDFKVGDIVQLLKTRPISKKKTFLAVPAPSRKSKK--AGSS-----GELGIPLQSQQE 134          
BLAST of CF504032 vs. ExPASy Swiss-Prot
Match: RR17_MAIZE (30S ribosomal protein S17, chloroplastic OS=Zea mays GN=RPS17 PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 8.556e-22
Identity = 51/110 (46.36%), Postives = 71/110 (64.55%), Query Frame = 1
Query:   37 STPLTRLSKPPSTPQNLPYSSFPQIKAMKKMQGRVVCASSDKTVAVEVVRLDPHPXXXXXXXXXXXXQAHDPENQFQVGDLVQLEKSRPISKTKSFIAVAMPPRNASKKA 366
            S+P   +S PP    +       +I+A +++ GRVV   +DKTV VEVVRL PHP            QAHDP+NQF+VGD+V+L+ SRPISKTK F+A+ +PPR+  +K+
Sbjct:    5 SSPFVSVSPPPPPLSSHGARPALRIEAARQLTGRVVTTKADKTVGVEVVRLAPHPKYKRRERIKKKYQAHDPDNQFKVGDVVELQPSRPISKTKHFLAIPLPPRDTRRKS 114          
BLAST of CF504032 vs. ExPASy Swiss-Prot
Match: RR17_ORYSJ (30S ribosomal protein S17, chloroplastic OS=Oryza sativa subsp. japonica GN=RPS17 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 4.246e-21
Identity = 48/87 (55.17%), Postives = 63/87 (72.41%), Query Frame = 1
Query:  106 QIKAMKKMQGRVVCASSDKTVAVEVVRLDPHPXXXXXXXXXXXXQAHDPENQFQVGDLVQLEKSRPISKTKSFIAVAMPPRNASKKA 366
            +I+A K++ GRVV   +DKTV VEVVRL PHP            QAHDP+NQF+VGD+V+L +SRPISKTK F+AV +PPR+  +K+
Sbjct:   33 RIQAAKQLTGRVVTTKADKTVGVEVVRLAPHPKYKRRERIKKKYQAHDPDNQFKVGDVVELRRSRPISKTKHFLAVPLPPRDTRRKS 119          
The following BLAST results are available for this feature:
BLAST of CF504032 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
RR17_ARATH6.748e-3558.4530S ribosomal protein S17, chloroplastic OS=Arabid... [more]
RR17_PEA7.990e-2851.4530S ribosomal protein S17, chloroplastic (Fragment... [more]
RR17_MAIZE8.556e-2246.3630S ribosomal protein S17, chloroplastic OS=Zea ma... [more]
RR17_ORYSJ4.246e-2155.1730S ribosomal protein S17, chloroplastic OS=Oryza ... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-520 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-12_E10 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504032 ID=CF504032|Name=CF504032|organism=Citrus sinensis|type=EST|length=549bp
AAACTCTCATCTCCCAAAACTCGCTTCCTCAATGGCTCCACTCCTCTTAC
TCGCCTCTCAAAACCCCCTTCCACTCCGCAAAATCTCCCCTATTCTTCGT
TTCCTCAAATCAAGGCCATGAAAAAAATGCAGGGCAGAGTTGTTTGTGCA
TCAAGCGACAAGACAGTTGCTGTTGAAGTTGTGCGTTTAGACCCACATCC
AAAGTACAAAAGAAGAATCAGAAAGAAGAAGAAGTATCAAGCTCATGACC
CTGAGAATCAATTCCAAGTTGGTGACCTTGTTCAGCTTGAAAAGTCCAGG
CCCATTAGCAAGACTAAATCTTTTATTGCTGTGGCCATGCCCCCAAGGAA
TGCGAGCAAGAAAGCTGCTGGTGAGAGTAGTAATGCCGGTAATAATGAGC
TTGGGATCCCTTCAGAGAGTGAGCAACAACTGGAGGCTTAGTTCCTTTAT
TGTTCATTTCCTGTGATTTTGTAATGCTTTAATACTGGTTAAGATGTTAA
TTTTTATTTGATGGCTATGAAGTATAAATGTGGTTGTTTTAAAAAAAAA
back to top