CF504421
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF504421 vs. ExPASy Swiss-Prot
Match: OLP1_SOLLC (Osmotin-like protein OS=Solanum lycopersicum PE=1 SV=1) HSP 1 Score: 114.775 bits (286), Expect = 1.401e-25 Identity = 51/66 (77.27%), Postives = 56/66 (84.85%), Query Frame = 2 Query: 5 DLSSYGVSLVDGFNVPMTATPHEGKGVCPVVGCRADLLATCPQNLQVRSPPGHGPVVACKSGCEAF 202 D S+YGVSLVDGFN+P+T TPHEGKGVCPVVGCRA+LL +CP LQ RS GHGPVV CKS CEAF Sbjct: 128 DFSTYGVSLVDGFNIPLTVTPHEGKGVCPVVGCRANLLESCPAVLQFRSHGGHGPVVGCKSACEAF 193
BLAST of CF504421 vs. ExPASy Swiss-Prot
Match: TLPH_ARATH (Thaumatin-like protein OS=Arabidopsis thaliana GN=At1g18250 PE=2 SV=2) HSP 1 Score: 67.781 bits (164), Expect = 1.964e-11 Identity = 35/68 (51.47%), Postives = 42/68 (61.76%), Query Frame = 2 Query: 5 DLSSYGVSLVDGFNVPMTATPHEGKGVCPVVGCRADLLATCPQNLQVRSPPGHGPVVACKSGCEAFGT 208 +L Y VSLVDG+N+ M+ P +G G C GC +DL CP LQVRS G VVACKS C AF + Sbjct: 117 ELDFYDVSLVDGYNLAMSIMPVKGSGQCSYAGCVSDLNQMCPVGLQVRSRNGK-RVVACKSACSAFNS 183
BLAST of CF504421 vs. ExPASy Swiss-Prot
Match: TLP_PRUAV (Glucan endo-1,3-beta-glucosidase OS=Prunus avium PE=1 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.350e-11 Identity = 33/64 (51.56%), Postives = 38/64 (59.38%), Query Frame = 2 Query: 17 YGVSLVDGFNVPMTATPHEGKGVCPVVGCRADLLATCPQNLQVRSPPGHGPVVACKSGCEAFGT 208 Y VSLVDGFN+PM+ TP G G C C A++ A CP LQ + G VVAC S C FGT Sbjct: 127 YDVSLVDGFNLPMSVTPQGGTGDCKTASCPANVNAVCPSELQKKG--SDGSVVACLSACVKFGT 188 The following BLAST results are available for this feature:
BLAST of CF504421 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF504421 ID=CF504421; Name=CF504421; organism=Citrus sinensis; type=EST; length=210bpback to top |