CF831928

Overview
NameCF831928
Unique NameCF831928
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length852
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6872 contig Csv1_Contig6872:177..1028. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF831928 vs. ExPASy Swiss-Prot
Match: RK2_MANES (50S ribosomal protein L2, chloroplastic OS=Manihot esculenta GN=rpl2-A PE=3 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 3.419e-13
Identity = 24/40 (60.00%), Postives = 28/40 (70.00%), Query Frame = -2
Query:  126 CWF-KNPAVRGVVMNSIDYLHWGGKGRVSICRKKASTPLG 242
            CW  K P VRGVVMN +D+ H GG+GR  I RKK +TP G
Sbjct:  213 CWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWG 252          

HSP 2 Score: 44.2838 bits (103), Expect = 3.419e-13
Identity = 20/28 (71.43%), Postives = 23/28 (82.14%), Query Frame = -3
Query:   65 KRPQPLWGYLAL*RRSRKKNKYNDNLIL 148
            K+P   WGY AL RRSRK+NKY+DNLIL
Sbjct:  245 KKPATPWGYPALGRRSRKRNKYSDNLIL 272          
BLAST of CF831928 vs. ExPASy Swiss-Prot
Match: RK2_VITVI (50S ribosomal protein L2, chloroplastic OS=Vitis vinifera GN=rpl2-A PE=3 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 3.420e-13
Identity = 24/40 (60.00%), Postives = 28/40 (70.00%), Query Frame = -2
Query:  126 CWF-KNPAVRGVVMNSIDYLHWGGKGRVSICRKKASTPLG 242
            CW  K P VRGVVMN +D+ H GG+GR  I RKK +TP G
Sbjct:  210 CWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPTTPWG 249          

HSP 2 Score: 44.2838 bits (103), Expect = 3.420e-13
Identity = 20/28 (71.43%), Postives = 23/28 (82.14%), Query Frame = -3
Query:   65 KRPQPLWGYLAL*RRSRKKNKYNDNLIL 148
            K+P   WGY AL RRSRK+NKY+DNLIL
Sbjct:  242 KKPTTPWGYPALGRRSRKRNKYSDNLIL 269          
BLAST of CF831928 vs. ExPASy Swiss-Prot
Match: RK2_POPTR (50S ribosomal protein L2, chloroplastic OS=Populus trichocarpa GN=rpl2-A PE=3 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 3.420e-13
Identity = 24/40 (60.00%), Postives = 28/40 (70.00%), Query Frame = -2
Query:  126 CWF-KNPAVRGVVMNSIDYLHWGGKGRVSICRKKASTPLG 242
            CW  K P VRGVVMN +D+ H GG+GR  I RKK +TP G
Sbjct:  210 CWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWG 249          

HSP 2 Score: 44.2838 bits (103), Expect = 3.420e-13
Identity = 20/28 (71.43%), Postives = 23/28 (82.14%), Query Frame = -3
Query:   65 KRPQPLWGYLAL*RRSRKKNKYNDNLIL 148
            K+P   WGY AL RRSRK+NKY+DNLIL
Sbjct:  242 KKPATPWGYPALGRRSRKRNKYSDNLIL 269          
BLAST of CF831928 vs. ExPASy Swiss-Prot
Match: RK2_MORIN (50S ribosomal protein L2, chloroplastic OS=Morus indica GN=rpl2-A PE=3 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 3.420e-13
Identity = 24/40 (60.00%), Postives = 28/40 (70.00%), Query Frame = -2
Query:  126 CWF-KNPAVRGVVMNSIDYLHWGGKGRVSICRKKASTPLG 242
            CW  K P VRGVVMN +D+ H GG+GR  I RKK +TP G
Sbjct:  210 CWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWG 249          

HSP 2 Score: 44.2838 bits (103), Expect = 3.420e-13
Identity = 20/28 (71.43%), Postives = 23/28 (82.14%), Query Frame = -3
Query:   65 KRPQPLWGYLAL*RRSRKKNKYNDNLIL 148
            K+P   WGY AL RRSRK+NKY+DNLIL
Sbjct:  242 KKPATPWGYPALGRRSRKRNKYSDNLIL 269          
BLAST of CF831928 vs. ExPASy Swiss-Prot
Match: RK2_GOSHI (50S ribosomal protein L2, chloroplastic OS=Gossypium hirsutum GN=rpl2-A PE=3 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 3.420e-13
Identity = 24/40 (60.00%), Postives = 28/40 (70.00%), Query Frame = -2
Query:  126 CWF-KNPAVRGVVMNSIDYLHWGGKGRVSICRKKASTPLG 242
            CW  K P VRGVVMN +D+ H GG+GR  I RKK +TP G
Sbjct:  210 CWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWG 249          

HSP 2 Score: 44.2838 bits (103), Expect = 3.420e-13
Identity = 20/28 (71.43%), Postives = 23/28 (82.14%), Query Frame = -3
Query:   65 KRPQPLWGYLAL*RRSRKKNKYNDNLIL 148
            K+P   WGY AL RRSRK+NKY+DNLIL
Sbjct:  242 KKPATPWGYPALGRRSRKRNKYSDNLIL 269          
BLAST of CF831928 vs. ExPASy Swiss-Prot
Match: RK2_CUCSA (50S ribosomal protein L2, chloroplastic OS=Cucumis sativus GN=rpl2-A PE=3 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 3.420e-13
Identity = 24/40 (60.00%), Postives = 28/40 (70.00%), Query Frame = -2
Query:  126 CWF-KNPAVRGVVMNSIDYLHWGGKGRVSICRKKASTPLG 242
            CW  K P VRGVVMN +D+ H GG+GR  I RKK +TP G
Sbjct:  210 CWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWG 249          

HSP 2 Score: 44.2838 bits (103), Expect = 3.420e-13
Identity = 20/28 (71.43%), Postives = 23/28 (82.14%), Query Frame = -3
Query:   65 KRPQPLWGYLAL*RRSRKKNKYNDNLIL 148
            K+P   WGY AL RRSRK+NKY+DNLIL
Sbjct:  242 KKPATPWGYPALGRRSRKRNKYSDNLIL 269          
BLAST of CF831928 vs. ExPASy Swiss-Prot
Match: RK2_CARPA (50S ribosomal protein L2, chloroplastic OS=Carica papaya GN=rpl2-A PE=3 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 3.420e-13
Identity = 24/40 (60.00%), Postives = 28/40 (70.00%), Query Frame = -2
Query:  126 CWF-KNPAVRGVVMNSIDYLHWGGKGRVSICRKKASTPLG 242
            CW  K P VRGVVMN +D+ H GG+GR  I RKK +TP G
Sbjct:  210 CWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWG 249          

HSP 2 Score: 44.2838 bits (103), Expect = 3.420e-13
Identity = 20/28 (71.43%), Postives = 23/28 (82.14%), Query Frame = -3
Query:   65 KRPQPLWGYLAL*RRSRKKNKYNDNLIL 148
            K+P   WGY AL RRSRK+NKY+DNLIL
Sbjct:  242 KKPATPWGYPALGRRSRKRNKYSDNLIL 269          
BLAST of CF831928 vs. ExPASy Swiss-Prot
Match: RK2B_POPAL (50S ribosomal protein L2-B, chloroplastic OS=Populus alba GN=rpl2-B PE=3 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 3.420e-13
Identity = 24/40 (60.00%), Postives = 28/40 (70.00%), Query Frame = -2
Query:  126 CWF-KNPAVRGVVMNSIDYLHWGGKGRVSICRKKASTPLG 242
            CW  K P VRGVVMN +D+ H GG+GR  I RKK +TP G
Sbjct:  210 CWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWG 249          

HSP 2 Score: 44.2838 bits (103), Expect = 3.420e-13
Identity = 20/28 (71.43%), Postives = 23/28 (82.14%), Query Frame = -3
Query:   65 KRPQPLWGYLAL*RRSRKKNKYNDNLIL 148
            K+P   WGY AL RRSRK+NKY+DNLIL
Sbjct:  242 KKPATPWGYPALGRRSRKRNKYSDNLIL 269          
BLAST of CF831928 vs. ExPASy Swiss-Prot
Match: RK2A_POPAL (50S ribosomal protein L2-A, chloroplastic OS=Populus alba GN=rpl2-A PE=3 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 3.420e-13
Identity = 24/40 (60.00%), Postives = 28/40 (70.00%), Query Frame = -2
Query:  126 CWF-KNPAVRGVVMNSIDYLHWGGKGRVSICRKKASTPLG 242
            CW  K P VRGVVMN +D+ H GG+GR  I RKK +TP G
Sbjct:  211 CWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWG 250          

HSP 2 Score: 44.2838 bits (103), Expect = 3.420e-13
Identity = 20/28 (71.43%), Postives = 23/28 (82.14%), Query Frame = -3
Query:   65 KRPQPLWGYLAL*RRSRKKNKYNDNLIL 148
            K+P   WGY AL RRSRK+NKY+DNLIL
Sbjct:  243 KKPATPWGYPALGRRSRKRNKYSDNLIL 270          
BLAST of CF831928 vs. ExPASy Swiss-Prot
Match: RK2_CITSI (50S ribosomal protein L2, chloroplastic OS=Citrus sinensis GN=rpl2-A PE=3 SV=1)

HSP 1 Score: 50.447 bits (119), Expect = 3.420e-13
Identity = 23/40 (57.50%), Postives = 28/40 (70.00%), Query Frame = -2
Query:  126 CWF-KNPAVRGVVMNSIDYLHWGGKGRVSICRKKASTPLG 242
            CW  K P VRGVVMN +D+ H GG+GR  I RK+ +TP G
Sbjct:  210 CWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKRPATPWG 249          

HSP 2 Score: 45.4394 bits (106), Expect = 3.420e-13
Identity = 21/28 (75.00%), Postives = 23/28 (82.14%), Query Frame = -3
Query:   65 KRPQPLWGYLAL*RRSRKKNKYNDNLIL 148
            KRP   WGY AL RRSRK+NKY+DNLIL
Sbjct:  242 KRPATPWGYPALGRRSRKRNKYSDNLIL 269          
The following BLAST results are available for this feature:
BLAST of CF831928 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 70
Match NameE-valueIdentityDescription
RK2_MANES3.419e-1360.0050S ribosomal protein L2, chloroplastic OS=Manihot... [more]
RK2_VITVI3.420e-1360.0050S ribosomal protein L2, chloroplastic OS=Vitis v... [more]
RK2_POPTR3.420e-1360.0050S ribosomal protein L2, chloroplastic OS=Populus... [more]
RK2_MORIN3.420e-1360.0050S ribosomal protein L2, chloroplastic OS=Morus i... [more]
RK2_GOSHI3.420e-1360.0050S ribosomal protein L2, chloroplastic OS=Gossypi... [more]
RK2_CUCSA3.420e-1360.0050S ribosomal protein L2, chloroplastic OS=Cucumis... [more]
RK2_CARPA3.420e-1360.0050S ribosomal protein L2, chloroplastic OS=Carica ... [more]
RK2B_POPAL3.420e-1360.0050S ribosomal protein L2-B, chloroplastic OS=Popul... [more]
RK2A_POPAL3.420e-1360.0050S ribosomal protein L2-A, chloroplastic OS=Popul... [more]
RK2_CITSI3.420e-1357.5050S ribosomal protein L2, chloroplastic OS=Citrus ... [more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS02_01A11_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01A11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF831928 ID=CF831928|Name=CF831928|organism=Citrus sinensis|type=EST|length=852bp
GCCCCTTTAGACTATGTCATGTGCATTAAAATTTCGATTTTCTCTCCTAT
TTAATACCGTTGAAAAGAATTAAATTATCATTATATTTATTCTTTTTCCT
GCTTCGTCTTCAAAGTGCAAGATAACCCCAAAGGGGTTGAGGCCTTTTTT
CTACAAATCGATACCCTTCCTTTACCACCCCAATGGAGGTAGTCTATGGA
ATTCATAACTACTCCTCTTACAGCAGGATTCTTGAACCAACAATCAGTTC
AAGAAATTAAAAAAAAGGCAGACCTGAAATAAGAATAGAACTCTCAAGTT
TTGCTTCAAAATATAAATAAGTGAAAACCATAGATTTCAGATTTATTAAT
GAAAGCTATGAGAAAGTTTGGTTTTACACCAGTGCATTATTTAGAGGGTT
CAATGAATGATGATACCCCTCTGTTAATATTGTTGTTACTCTGCAGCTGG
TTTGCTAGTCTCATCCTTGCATCTAGGTTGATGATTGTGATTTTTCAACT
CATCTCCAGCCACAAGAAAGAATGCAGTGTGTCTGAAAAAATTCATCATT
TTGATTTTTGAGTCAGCATCAATTTCTGGGGTACTGTCTAGTGCAATCTG
CATATGATGTAACCATCTCTCTGCAGCTTGATGTGTTACTGGGAATGGTC
GATGACGTCCAATTAATGCAGGATGGCCTTTCCTCTGAGAATACAGAGGA
GGCCCTCCCATTCTCTGCACAAAAAACTCATATTGGTTCTGAATTGCTTC
TTCTTTATTCGAATTTGCAAAAATTGACCTAAACCACTCTTCCTCGTCGT
CATAAACCCTGGTATAGAAGTTGGTGGAGAGATTGATGAAAGTTTGAAGG
CC
back to top