CF835329

Overview
NameCF835329
Unique NameCF835329
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length732
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF835329 vs. ExPASy Swiss-Prot
Match: JOIN_SOLLC (MADS-box protein JOINTLESS OS=Solanum lycopersicum GN=J PE=1 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 3.993e-67
Identity = 130/176 (73.86%), Postives = 152/176 (86.36%), Query Frame = 2
Query:  200 MAREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSSSMKEILEKHRVHSKNLERVDQPSVELQLLENNNYSMLFKEAAEKSHLLRQMRGEEIHGLSLEELQKLERSLEVGLGRVXXXXXXXXXXXXNELQRRGKLLMEENERLRQQVAEVSN 727
            MAREKIQIKKIDN+TARQVTFSKRRRG+FKKAEELSVLCDADVALIIFS+TGKLF+YSSSSMK+ILE+  +HSKNLE++DQPS+ELQL+EN+NYS L KE +EKSH LRQMRGEE+ GL++EELQ+LERSLE GL RV            N+LQ++G  LMEENE+LRQQV E+SN
Sbjct:    1 MAREKIQIKKIDNSTARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDYSSSSMKQILERRDLHSKNLEKLDQPSLELQLVENSNYSRLSKEISEKSHRLRQMRGEELQGLNIEELQQLERSLETGLSRVIERKGDKIMREINQLQQKGMHLMEENEKLRQQVMEISN 176          
BLAST of CF835329 vs. ExPASy Swiss-Prot
Match: SVP_ARATH (MADS-box protein SVP OS=Arabidopsis thaliana GN=SVP PE=1 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 2.507e-61
Identity = 118/175 (67.43%), Postives = 148/175 (84.57%), Query Frame = 2
Query:  200 MAREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSSSMKEILEKHRVHSKNLERVDQPSVELQLLENNNYSMLFKEAAEKSHLLRQMRGEEIHGLSLEELQKLERSLEVGLGRVXXXXXXXXXXXXNELQRRGKLLMEENERLRQQVAEVS 724
            MAREKIQI+KIDNATARQVTFSKRRRG+FKKAEELSVLCDADVALIIFS+TGKLFE+ SSSMKE+LE+H + SKNLE++DQPS+ELQL+EN++++ + KE A+KSH LRQMRGEE+ GL +EELQ+LE++LE GL RV            +ELQ++G  LM+EN+RLRQQ  +++
Sbjct:    1 MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSSSMKEVLERHNLQSKNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGLDIEELQQLEKALETGLTRVIETKSDKIMSEISELQKKGMQLMDENKRLRQQGTQLT 175          
BLAST of CF835329 vs. ExPASy Swiss-Prot
Match: MAD22_ORYSJ (MADS-box transcription factor 22 OS=Oryza sativa subsp. japonica GN=MADS22 PE=2 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 3.755e-49
Identity = 102/177 (57.63%), Postives = 136/177 (76.84%), Query Frame = 2
Query:  200 MAREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSSSMKEILEKHRVHSKNLERVDQPSVELQLLENNNYSMLFKEAAEKSHLLRQMRGEEIHGLSLEELQKLERSLEVGLGRVXXXXXXXXXXXXNELQRRGKLLMEENERLRQQVAEVSNA 730
            MARE+ +IK+I++A ARQVTFSKRRRG+FKKAEELSVLCDADVALI+FS+TGKL  ++SSSM EI++K+  HS NL + +QPS++L  LE++ Y+ L ++ AE S  LRQMRGEE+ GLS++ELQ+LE++LE GL RV            +ELQR+   L EEN +LR QV+++S A
Sbjct:    1 MARERREIKRIESAAARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSTGKLSHFASSSMNEIIDKYNTHSNNLGKAEQPSLDLN-LEHSKYAHLNEQLAEASLRLRQMRGEELEGLSIDELQQLEKNLEAGLHRVMLTKDQQFMEQISELQRKSSQLAEENMQLRNQVSQISPA 176          
BLAST of CF835329 vs. ExPASy Swiss-Prot
Match: MAD55_ORYSJ (MADS-box transcription factor 55 OS=Oryza sativa subsp. japonica GN=MADS55 PE=2 SV=2)

HSP 1 Score: 181.415 bits (459), Expect = 4.296e-45
Identity = 101/199 (50.75%), Postives = 136/199 (68.34%), Query Frame = 2
Query:  200 MAREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSSSMKEILEKHRVHSKNLERVD-QPSVELQL---------------------LENNNYSMLFKEAAEKSHLLRQMRGEEIHGLSLEELQKLERSLEVGLGRVXXXXXXXXXXXXNELQRRGKLLMEENERLRQQVAEVSNA 730
            MARE+ +I++I++A ARQVTFSKRRRG+FKKAEEL+VLCDADVAL++FS+TGKL +++SS+M EI++K+  HSKNL + D QPS++L                       LE++  S L ++ AE S  LRQMRGEE+ GLS+EELQ++E++LE GL RV            +ELQR+G  L EEN RLR Q+ +V  A
Sbjct:    1 MARERREIRRIESAAARQVTFSKRRRGLFKKAEELAVLCDADVALVVFSSTGKLSQFASSNMNEIIDKYTTHSKNLGKTDKQPSIDLNFFLIILLRTYTNSYAYIHLLLQLEHSKCSSLNEQLAEASLQLRQMRGEELEGLSVEELQQMEKNLEAGLQRVLCTKDQQFMQEISELQRKGIQLAEENMRLRDQMPQVPTA 199          
BLAST of CF835329 vs. ExPASy Swiss-Prot
Match: MAD47_ORYSJ (MADS-box transcription factor 47 OS=Oryza sativa subsp. japonica GN=MADS47 PE=1 SV=2)

HSP 1 Score: 177.178 bits (448), Expect = 8.103e-44
Identity = 93/185 (50.27%), Postives = 135/185 (72.97%), Query Frame = 2
Query:  158 GRSQQ*QLASKGKEMAREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSSSMKEILEKHRVHSKNLERVDQPSVELQLLENNNYSMLFKEAAEKSHLLRQMRGEEIHGLSLEELQKLERSLEVGLGRVXXXXXXXXXXXXNELQRRGKLLMEENERLRQQV 712
            GR +    A+ GK   RE+I I++IDN  ARQVTFSKRRRG+FKKAEELS+LCDA+V L++FSATGKLF+++S+SM++I++++  HSK L+R +   ++LQ  +++  + L +E AE S  LRQMRGEE+H L++E+LQ+LE+SLE GLG V            + L+R+   L+EEN RL++Q+
Sbjct:    9 GRGEGEGRAATGK---RERIAIRRIDNLAARQVTFSKRRRGLFKKAEELSILCDAEVGLVVFSATGKLFQFASTSMEQIIDRYNSHSKTLQRAEPSQLDLQGEDSSTCARLKEELAETSLRLRQMRGEELHRLNVEQLQELEKSLESGLGSVLKTKSKKILDEIDGLERKRMQLIEENLRLKEQL 190          
BLAST of CF835329 vs. ExPASy Swiss-Prot
Match: MAD27_ORYSJ (MADS-box transcription factor 27 OS=Oryza sativa subsp. japonica GN=MADS27 PE=2 SV=2)

HSP 1 Score: 140.584 bits (353), Expect = 8.404e-33
Identity = 74/173 (42.77%), Postives = 116/173 (67.05%), Query Frame = 2
Query:  200 MAREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSSSMKEILEKHRVHSKNLERVDQPSVELQLLENNNYSMLFK-EAAEKSHLLRQMRGEEIHGLSLEELQKLERSLEVGLGRVXXXXXXXXXXXXNELQRRGKLLMEENERLRQQVA 715
            M R KI I++IDN+T+RQVTFSKRR GIFKKA+EL++LCDA+V L+IFS+TG+L+EYSS+SMK +++++       + V  P+ EL+  +    S+  +    +++H  RQ+ GE++ GL+++ELQ LE  LE+ L  V            +EL R+G L+ +EN  L ++++
Sbjct:    1 MGRGKIVIRRIDNSTSRQVTFSKRRNGIFKKAKELAILCDAEVGLMIFSSTGRLYEYSSTSMKSVIDRYGKSKDEQQAVANPNSELKFWQREAASLRQQLHNLQENH--RQLMGEDLSGLNVKELQSLENQLEISLRSVRTKKDHVLIDEIHELNRKGSLVHQENMELYKKIS 171          
BLAST of CF835329 vs. ExPASy Swiss-Prot
Match: AP1_SINAL (Floral homeotic protein APETALA 1 OS=Sinapis alba GN=AP1 PE=2 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 1.136e-29
Identity = 74/178 (41.57%), Postives = 108/178 (60.67%), Query Frame = 2
Query:  200 MAREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSSS-MKEILEKHRVHSKNLERVDQPSVELQLLENNNYSMLFKEAAEKSHLL----RQMRGEEIHGLSLEELQKLERSLEVGLGRVXXXXXXXXXXXXNELQRRGKLLMEENERLRQQVAE 718
            M R ++Q+K+I+N   RQVTFSKRR G+ KKA E+SVLCDA+VAL++FS  GKLFEYS+ S M++ILE++  +S    ++  P  ++    N N+SM +     K  LL    R   GE++  +S +ELQ LE+ L+  L  +            NELQR+ K + E+N  L +Q+ E
Sbjct:    1 MGRGRVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALVVFSHKGKLFEYSTDSCMEKILERYERYSYAERQLIAPESDV----NTNWSMEYNRLKAKIELLERNQRHYLGEDLQAMSSKELQNLEQQLDTALKHIRSRKNQLMHDSINELQRKEKAIQEQNSMLSKQIKE 174          
BLAST of CF835329 vs. ExPASy Swiss-Prot
Match: CAL_ARATH (Transcription factor CAULIFLOWER OS=Arabidopsis thaliana GN=CAL PE=1 SV=3)

HSP 1 Score: 129.413 bits (324), Expect = 1.937e-29
Identity = 75/181 (41.44%), Postives = 108/181 (59.67%), Query Frame = 2
Query:  200 MAREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSSS-MKEILEKHRVHSKNLERVDQPSVELQLLENNNYSMLFKEAAEKSHLL----RQMRGEEIHGLSLEELQKLERSLEVGLGRVXXXXXXXXXXXXNELQRRGKLLMEENERLRQQVAEVSN 727
            M R ++++K+I+N   RQVTFSKRR G+ KKA+E+SVLCDA+V+LI+FS  GKLFEYSS S M+++LE++  +S    ++  P   +      N+SM +     K  LL    R   GEE+  +SL++LQ LE+ LE  L  +            N LQR+ K + EEN  L +Q+ E  N
Sbjct:    1 MGRGRVELKRIENKINRQVTFSKRRTGLLKKAQEISVLCDAEVSLIVFSHKGKLFEYSSESCMEKVLERYERYSYAERQLIAPDSHVN--AQTNWSMEYSRLKAKIELLERNQRHYLGEELEPMSLKDLQNLEQQLETALKHIRSRKNQLMNESLNHLQRKEKEIQEENSMLTKQIKEREN 179          
BLAST of CF835329 vs. ExPASy Swiss-Prot
Match: AP1_ARATH (Floral homeotic protein APETALA 1 OS=Arabidopsis thaliana GN=AP1 PE=1 SV=2)

HSP 1 Score: 128.642 bits (322), Expect = 3.305e-29
Identity = 73/178 (41.01%), Postives = 108/178 (60.67%), Query Frame = 2
Query:  200 MAREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSSS-MKEILEKHRVHSKNLERVDQPSVELQLLENNNYSMLFKEAAEKSHLL----RQMRGEEIHGLSLEELQKLERSLEVGLGRVXXXXXXXXXXXXNELQRRGKLLMEENERLRQQVAE 718
            M R ++Q+K+I+N   RQVTFSKRR G+ KKA E+SVLCDA+VAL++FS  GKLFEYS+ S M++ILE++  +S    ++  P  ++    N N+SM +     K  LL    R   GE++  +S +ELQ LE+ L+  L  +            NELQ++ K + E+N  L +Q+ E
Sbjct:    1 MGRGRVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALVVFSHKGKLFEYSTDSCMEKILERYERYSYAERQLIAPESDV----NTNWSMEYNRLKAKIELLERNQRHYLGEDLQAMSPKELQNLEQQLDTALKHIRTRKNQLMYESINELQKKEKAIQEQNSMLSKQIKE 174          
BLAST of CF835329 vs. ExPASy Swiss-Prot
Match: AGL21_ARATH (Agamous-like MADS-box protein AGL21 OS=Arabidopsis thaliana GN=AGL21 PE=1 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 3.305e-29
Identity = 69/176 (39.20%), Postives = 117/176 (66.48%), Query Frame = 2
Query:  200 MAREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSSSMKEILEKHRVHSKNLERVDQPSVELQLLENNNYSMLFKE--AAEKSHLLRQMRGEEIHGLSLEELQKLERSLEVGLGRVXXXXXXXXXXXXNELQRRGKLLMEENERLRQQVAEV 721
            M R KI I++ID++T+RQVTFSKRR+G+ KKA+EL++LCDA+V LIIFS+TGKL++++SSSMK +++++       +++  P+ E++  +    ++L +E  A +++H  RQM GE+++GLS+ EL  LE  +E+ L  +             EL ++  L+ +EN  L ++V  +
Sbjct:    1 MGRGKIVIQRIDDSTSRQVTFSKRRKGLIKKAKELAILCDAEVGLIIFSSTGKLYDFASSSMKSVIDRYNKSKIEQQQLLNPASEVKFWQ-REAAVLRQELHALQENH--RQMMGEQLNGLSVNELNSLENQIEISLRGIRMRKEQLLTQEIQELSQKRNLIHQENLDLSRKVQRI 173          
The following BLAST results are available for this feature:
BLAST of CF835329 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 122
Match NameE-valueIdentityDescription
JOIN_SOLLC3.993e-6773.86MADS-box protein JOINTLESS OS=Solanum lycopersicum... [more]
SVP_ARATH2.507e-6167.43MADS-box protein SVP OS=Arabidopsis thaliana GN=SV... [more]
MAD22_ORYSJ3.755e-4957.63MADS-box transcription factor 22 OS=Oryza sativa s... [more]
MAD55_ORYSJ4.296e-4550.75MADS-box transcription factor 55 OS=Oryza sativa s... [more]
MAD47_ORYSJ8.103e-4450.27MADS-box transcription factor 47 OS=Oryza sativa s... [more]
MAD27_ORYSJ8.404e-3342.77MADS-box transcription factor 27 OS=Oryza sativa s... [more]
AP1_SINAL1.136e-2941.57Floral homeotic protein APETALA 1 OS=Sinapis alba ... [more]
CAL_ARATH1.937e-2941.44Transcription factor CAULIFLOWER OS=Arabidopsis th... [more]
AP1_ARATH3.305e-2941.01Floral homeotic protein APETALA 1 OS=Arabidopsis t... [more]
AGL21_ARATH3.305e-2939.20Agamous-like MADS-box protein AGL21 OS=Arabidopsis... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01A22_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01A22, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835329 ID=CF835329|Name=CF835329|organism=Citrus sinensis|type=EST|length=732bp
TTTTTTTTTTCCTTTTTTTAATCTCTTTTCCTTCTCCCATATTCTCTCGT
CTCTCTCTATCGCTCATTGGTGGCATTTTCAAAGTCTCCATTCCGAAGTT
TTAAACTCTCCCACAAAACCAAACCACATTACCAGCCGATCTCCATAAGC
CAAATTGGGAAGATCACAGCAGTAACAGCTAGCAAGCAAGGGCAAAGAGA
TGGCGAGAGAAAAGATTCAGATCAAGAAAATTGACAACGCAACGGCGAGG
CAAGTCACTTTCTCTAAGAGACGAAGAGGGATTTTCAAGAAAGCTGAAGA
GCTTTCTGTTCTTTGCGATGCCGATGTTGCTCTGATCATCTTCTCCGCCA
CAGGCAAGCTCTTCGAATATTCCAGCTCAAGCATGAAGGAAATCTTAGAA
AAGCACCGTGTGCACTCAAAGAACCTTGAGAGGGTGGATCAACCATCTGT
TGAGTTGCAGCTGTTGGAGAACAACAACTACTCCATGTTGTTCAAGGAAG
CTGCTGAAAAAAGCCATCTGCTGAGGCAAATGAGAGGTGAGGAGATCCAT
GGATTAAGTTTAGAAGAATTGCAGAAGCTTGAAAGGTCTCTTGAAGTTGG
ATTGGGACGAGTGATAGAAAAGAAGGAAGAAAAGATTACAAAGGAGATTA
ATGAACTCCAAAGAAGGGGAAAGTTATTGATGGAGGAGAATGAGCGATTA
AGACAGCAAGTGGCGGAGGTATCAAATGCATA
back to top