CF835373

Overview
NameCF835373
Unique NameCF835373
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length537
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10991 contig Csv1_Contig10991:319..855. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835373 vs. ExPASy Swiss-Prot
Match: ARFB_ARATH (Auxin response factor 2 OS=Arabidopsis thaliana GN=ARF2 PE=1 SV=2)

HSP 1 Score: 273.092 bits (697), Expect = 5.925e-73
Identity = 132/166 (79.52%), Postives = 143/166 (86.14%), Query Frame = 2
Query:   41 ERQNSNSTTSGV-KRVGDPEMALYTELWHACAGPLVTVPREGERVYYFPQGHIEQVEASTNQVADQQMPVYDLPSKILCRVINVQLKAEPDTDEAFAQVTLLPESNQDENAVEKEXXXXXXXRFHVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPPT 535
            E Q SNST S   +R  DPE ALY ELWHACAGPLVTVPR+ +RV+YFPQGHIEQVEASTNQ A+QQMP+YDLPSK+LCRVINV LKAE DTDE +AQ+TLLPE+NQDENA+EKE       RF VHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPPT
Sbjct:   36 EGQKSNSTRSAAAERALDPEAALYRELWHACAGPLVTVPRQDDRVFYFPQGHIEQVEASTNQAAEQQMPLYDLPSKLLCRVINVDLKAEADTDEVYAQITLLPEANQDENAIEKEAPLPPPPRFQVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPPT 201          
BLAST of CF835373 vs. ExPASy Swiss-Prot
Match: ARFW_ORYSJ (Auxin response factor 23 OS=Oryza sativa subsp. japonica GN=ARF23 PE=1 SV=2)

HSP 1 Score: 227.254 bits (578), Expect = 3.729e-59
Identity = 114/155 (73.55%), Postives = 127/155 (81.94%), Query Frame = 2
Query:   86 GDPEMALYTELWHACAGPLVTVPREGERVYYFPQGHIEQVEASTNQVADQQMPVYDLPSKILCRVINVQLKAEPDTDEAFAQVTLLPESNQ--DENAVEKE---XXXXXXXRFHVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPPT 535
            G  E AL+TELW ACAGPLVTVPR GE+V+YFPQGHIEQVEASTNQV +Q+M +Y+LP KILC V+NV+LKAEPDTDE +AQ+TLLPES Q  D  + E+E          R  VHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPPT
Sbjct:   32 GGGEDALFTELWSACAGPLVTVPRVGEKVFYFPQGHIEQVEASTNQVGEQRMQLYNLPWKILCEVMNVELKAEPDTDEVYAQLTLLPESKQQEDNGSTEEEVPSAPAAGHVRPRVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPPT 186          
BLAST of CF835373 vs. ExPASy Swiss-Prot
Match: ARFW_ORYSI (Auxin response factor 23 OS=Oryza sativa subsp. indica GN=ARF23 PE=2 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 1.850e-58
Identity = 113/155 (72.90%), Postives = 126/155 (81.29%), Query Frame = 2
Query:   86 GDPEMALYTELWHACAGPLVTVPREGERVYYFPQGHIEQVEASTNQVADQQMPVYDLPSKILCRVINVQLKAEPDTDEAFAQVTLLPESNQ--DENAVEKE---XXXXXXXRFHVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPPT 535
            G  E AL+TELW ACAGPLVTVPR GE+V+YFPQGHIEQVEASTNQV +Q+M +Y+LP KILC V+NV+LKAEPDTDE +AQ+TLLPE  Q  D  + E+E          R  VHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPPT
Sbjct:   32 GGGEDALFTELWSACAGPLVTVPRVGEKVFYFPQGHIEQVEASTNQVGEQRMQLYNLPWKILCEVMNVELKAEPDTDEVYAQLTLLPELKQQEDNGSTEEEVPSAPAAGHVRPRVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPPT 186          
BLAST of CF835373 vs. ExPASy Swiss-Prot
Match: ARFD_ORYSJ (Auxin response factor 4 OS=Oryza sativa subsp. japonica GN=ARF4 PE=2 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 7.032e-58
Identity = 112/152 (73.68%), Postives = 123/152 (80.92%), Query Frame = 2
Query:   86 GDPEMALYTELWHACAGPLVTVPREGERVYYFPQGHIEQVEASTNQVADQQMPVYDLPSKILCRVINVQLKAEPDTDEAFAQVTLLPESNQDENAVEK--EXXXXXXXRFHVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPPT 535
            GDP   LY ELWHACAGPLVTVPR G+ V+YFPQGHIEQVEAS NQVAD QM +YDLPSK+LCRV+NV+LKAE DTDE +AQV L+PE  Q+E AVEK          R  V SFCKTLTASDTSTHGGFSVLRRHADECLPPLDM++ PPT
Sbjct:   18 GDP---LYDELWHACAGPLVTVPRVGDLVFYFPQGHIEQVEASMNQVADSQMRLYDLPSKLLCRVLNVELKAEQDTDEVYAQVMLMPEPEQNEMAVEKTTPTSGPVQARPPVRSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMTQSPPT 166          
BLAST of CF835373 vs. ExPASy Swiss-Prot
Match: ARFA_ARATH (Auxin response factor 1 OS=Arabidopsis thaliana GN=ARF1 PE=1 SV=2)

HSP 1 Score: 214.157 bits (544), Expect = 3.266e-55
Identity = 101/144 (70.14%), Postives = 120/144 (83.33%), Query Frame = 2
Query:  101 ALYTELWHACAGPLVTVPREGERVYYFPQGHIEQVEASTNQVADQQMPVYDLPSKILCRVINVQLKAEPDTDEAFAQVTLLPESNQDENAVEKEXXXXXXXRFHVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPP 532
            AL  ELWHACAGPLVT+PREGERVYYFP+GH+EQ+EAS +Q  +QQMP ++LPSKILC+VIN+Q +AEP+TDE +AQ+TLLPE +Q E     +       +  VHSFCKTLTASDTSTHGGFSVLRRHAD+CLPPLDMS+QPP
Sbjct:   18 ALCRELWHACAGPLVTLPREGERVYYFPEGHMEQLEASMHQGLEQQMPSFNLPSKILCKVINIQRRAEPETDEVYAQITLLPELDQSE-PTSPDAPVQEPEKCTVHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPP 160          
BLAST of CF835373 vs. ExPASy Swiss-Prot
Match: ARFX_ORYSJ (Auxin response factor 24 OS=Oryza sativa subsp. japonica GN=ARF24 PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 2.765e-54
Identity = 109/157 (69.43%), Postives = 121/157 (77.07%), Query Frame = 2
Query:  104 LYTELWHACAGPLVTVPREGERVYYFPQGHIEQVEASTNQVADQQ-MPVYDLPSKILCRVINVQLKAEPDTDEAFAQVTLLPESNQDENA----------VEKEXXXXXXX--RFHVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPPT 535
            L+ ELW ACAGPLVTVP  GERV+Y PQGHIEQVEASTNQVA+QQ  P+Y+LP KI C+V+NV+LKAEPDTDE +AQ+TLLPE  QD N           VE+E         R  VHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMS+ PPT
Sbjct:   29 LFVELWRACAGPLVTVPAVGERVFYLPQGHIEQVEASTNQVAEQQGAPLYNLPWKIPCKVMNVELKAEPDTDEVYAQLTLLPEKQQDGNGSGNGNVSKDKVEEEEVVPPAATERPRVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSQHPPT 185          
BLAST of CF835373 vs. ExPASy Swiss-Prot
Match: ARFG_ORYSJ (Auxin response factor 7 OS=Oryza sativa subsp. japonica GN=ARF7 PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 3.611e-54
Identity = 97/144 (67.36%), Postives = 121/144 (84.03%), Query Frame = 2
Query:  101 ALYTELWHACAGPLVTVPREGERVYYFPQGHIEQVEASTNQVADQQMPVYDLPSKILCRVINVQLKAEPDTDEAFAQVTLLPESNQDENAVEKEXXXXXXXRFHVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPP 532
            ALY ELWHACAGPLVTVPR+GE VYYFPQGH+EQ+EAST+Q  DQ +P+++LPSKILC+V+NV+L+AE D+DE +AQ+ L PE++Q+E     +       + +VHSFCKTLTASDTSTHGGFSVLRRHA+ECLPPLDM++ PP
Sbjct:   22 ALYRELWHACAGPLVTVPRQGELVYYFPQGHMEQLEASTDQQLDQHLPLFNLPSKILCKVVNVELRAETDSDEVYAQIMLQPEADQNE-LTSPKPEPHEPEKCNVHSFCKTLTASDTSTHGGFSVLRRHAEECLPPLDMTQNPP 164          
BLAST of CF835373 vs. ExPASy Swiss-Prot
Match: ARFI_ORYSJ (Auxin response factor 9 OS=Oryza sativa subsp. japonica GN=ARF9 PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 1.517e-52
Identity = 96/144 (66.67%), Postives = 116/144 (80.56%), Query Frame = 2
Query:  101 ALYTELWHACAGPLVTVPREGERVYYFPQGHIEQVEASTNQVADQQMPVYDLPSKILCRVINVQLKAEPDTDEAFAQVTLLPESNQDENAVEKEXXXXXXXRFHVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPP 532
            AL+ ELWHACAGPLVTVP+ GERVYYFPQGH+EQ+EASTNQ  DQ +P+++LPSKILC V+NV+L+AE D+DE +AQ+ L PE++Q E     +       +   HSFCKTLTASDTSTHGGFSVLRRHA+ECLP LDMS+ PP
Sbjct:   20 ALFRELWHACAGPLVTVPKRGERVYYFPQGHMEQLEASTNQQLDQYLPMFNLPSKILCSVVNVELRAEADSDEVYAQIMLQPEADQSE-LTSLDPELQDLEKCTAHSFCKTLTASDTSTHGGFSVLRRHAEECLPQLDMSQNPP 162          
BLAST of CF835373 vs. ExPASy Swiss-Prot
Match: ARFK_ARATH (Auxin response factor 11 OS=Arabidopsis thaliana GN=ARF11 PE=2 SV=3)

HSP 1 Score: 184.882 bits (468), Expect = 2.122e-46
Identity = 94/152 (61.84%), Postives = 114/152 (75.00%), Query Frame = 2
Query:   83 VGDPEMALYTELWHACAGPLVTVPREGERVYYFPQGHIEQVEASTNQ-VADQQMPVYDLPSKILCRVINVQLKAEPDTDEAFAQVTLLPESNQDENAVEKEXXXXXXXRFHVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPPT 535
            +G  +  LYTELW ACAGPLV VPR GERV+YFPQGH+EQ+ ASTNQ V DQ++PV++LP KILCRV++V LKAE +TDE +AQ+TL PE +Q E     +       +  V SF K LTASDTSTHGGFSVLR+HA ECLP LDM++  PT
Sbjct:   32 LGSNDDELYTELWKACAGPLVEVPRYGERVFYFPQGHMEQLVASTNQGVVDQEIPVFNLPPKILCRVLSVTLKAEHETDEVYAQITLQPEEDQSE-PTSLDPPLVEPAKPTVDSFVKILTASDTSTHGGFSVLRKHATECLPSLDMTQPTPT 182          
BLAST of CF835373 vs. ExPASy Swiss-Prot
Match: ARFI_ARATH (Auxin response factor 9 OS=Arabidopsis thaliana GN=ARF9 PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 6.827e-45
Identity = 89/145 (61.38%), Postives = 106/145 (73.10%), Query Frame = 2
Query:  104 LYTELWHACAGPLVTVPREGERVYYFPQGHIEQVEASTNQVADQQM-PVYDLPSKILCRVINVQLKAEPDTDEAFAQVTLLPESNQDENAVEKEXXXXXXXRFHVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPPT 535
            LY ELW  CAGPLV VP+  ERVYYFPQGH+EQ+EAST QV    M P++ LP KILC V+NV L+AE DTDE +AQ+TL+P   + +  +  +       R  VHSF K LTASDTSTHGGFSVLR+HA ECLPPLDM++Q PT
Sbjct:    9 LYDELWKLCAGPLVDVPQAQERVYYFPQGHMEQLEASTQQVDLNTMKPLFVLPPKILCNVMNVSLQAEKDTDEVYAQITLIPVGTEVDEPMSPDPSPPELQRPKVHSFSKVLTASDTSTHGGFSVLRKHATECLPPLDMTQQTPT 153          
The following BLAST results are available for this feature:
BLAST of CF835373 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 54
Match NameE-valueIdentityDescription
ARFB_ARATH5.925e-7379.52Auxin response factor 2 OS=Arabidopsis thaliana GN... [more]
ARFW_ORYSJ3.729e-5973.55Auxin response factor 23 OS=Oryza sativa subsp. ja... [more]
ARFW_ORYSI1.850e-5872.90Auxin response factor 23 OS=Oryza sativa subsp. in... [more]
ARFD_ORYSJ7.032e-5873.68Auxin response factor 4 OS=Oryza sativa subsp. jap... [more]
ARFA_ARATH3.266e-5570.14Auxin response factor 1 OS=Arabidopsis thaliana GN... [more]
ARFX_ORYSJ2.765e-5469.43Auxin response factor 24 OS=Oryza sativa subsp. ja... [more]
ARFG_ORYSJ3.611e-5467.36Auxin response factor 7 OS=Oryza sativa subsp. jap... [more]
ARFI_ORYSJ1.517e-5266.67Auxin response factor 9 OS=Oryza sativa subsp. jap... [more]
ARFK_ARATH2.122e-4661.84Auxin response factor 11 OS=Arabidopsis thaliana G... [more]
ARFI_ARATH6.827e-4561.38Auxin response factor 9 OS=Arabidopsis thaliana GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01C04_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01C04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835373 ID=CF835373|Name=CF835373|organism=Citrus sinensis|type=EST|length=537bp
ACCCATTAAGTCTTGTAACGAGACTGGTAGAATTCCTATGGAACGGCAGA
ATAGTAATTCCACAACTTCCGGTGTCAAACGAGTTGGGGACCCCGAAATG
GCGCTCTACACGGAGCTGTGGCATGCCTGCGCCGGACCTTTGGTCACCGT
CCCTCGAGAAGGCGAGCGCGTGTACTACTTCCCTCAAGGCCACATAGAGC
AGGTGGAAGCGTCAACTAATCAGGTCGCAGACCAGCAAATGCCAGTTTAT
GATCTTCCTTCAAAGATACTCTGTCGTGTAATTAACGTCCAATTAAAGGC
TGAACCTGATACTGATGAGGCGTTTGCTCAAGTGACTTTACTTCCAGAGT
CAAACCAAGATGAGAACGCGGTGGAGAAAGAACCACCTCCACCCCCGCCA
CCAAGATTTCACGTGCATTCGTTTTGTAAAACACTAACGGCATCGGATAC
AAGTACTCATGGTGGGTTTTCGGTACTGAGACGGCATGCTGATGAGTGTC
TTCCACCCTTGGACATGTCACGGCAGCCTCCCACACA
back to top