CF835585

Overview
NameCF835585
Unique NameCF835585
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length786
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5197 contig Csv1_Contig5197:513..1295. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835585 vs. ExPASy Swiss-Prot
Match: RD23D_ARATH (Putative DNA repair protein RAD23-4 OS=Arabidopsis thaliana GN=RAD23-4 PE=2 SV=2)

HSP 1 Score: 267.7 bits (683), Expect = 5.173e-71
Identity = 137/187 (73.26%), Postives = 153/187 (81.82%), Query Frame = -1
Query:  226 QAEVQPVARAPGNGQAANSXXXXXXXXXXXXXTSSGPNANPLDLFPQGLPDVGSGAAGAGSLDFLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVQGGEGNLGDQLAGLMPQSIQVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHEFED 786
            QAE+ PVA+AP  G+ A +              + GPNANPL+LFPQG+P   +GA GAG+LDFLRNS QFQ LRAMVQANPQ+LQPMLQELGKQNPQLVRLIQEHQADFLRLINEPV+ GE N+ +QL   MPQ++ VTPEEREAIERLE MGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct:  193 QAEIPPVAQAPATGEQAANPLAQPQQAAAPAAATGGPNANPLNLFPQGMPAADAGA-GAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVE-GEENVMEQLEAAMPQAVTVTPEEREAIERLEGMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFED 377          
BLAST of CF835585 vs. ExPASy Swiss-Prot
Match: RD23C_ARATH (Putative DNA repair protein RAD23-3 OS=Arabidopsis thaliana GN=RAD23-3 PE=2 SV=2)

HSP 1 Score: 260.381 bits (664), Expect = 8.258e-69
Identity = 143/192 (74.48%), Postives = 156/192 (81.25%), Query Frame = -1
Query:  226 QAEVQPVARAPGN-GQAANSXXXXXXXXXXXXXTSSGPNANPLDLFPQGLPDVGSGAAGAGSLDFLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVQGG--EGNLGDQLAGLM--PQSIQVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHEFED 786
            QAEV PVAR P + GQ AN               +SGPNANPLDLFPQGLP+VG G  GAG+LDFLRNS QFQ LRAMVQANPQ+LQPMLQELGKQNP L+RLIQ+HQADFLRLINEPV+GG   GNL  Q+A  M  PQ+IQVT EEREAIERLEAMGF+RA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct:  232 QAEVPPVARPPASAGQPANPPAQTQQPAAAP---ASGPNANPLDLFPQGLPNVG-GNPGAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNLLGQMAAGMPQPQAIQVTHEEREAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE 419          
BLAST of CF835585 vs. ExPASy Swiss-Prot
Match: RAD23_ORYSJ (Probable DNA repair protein RAD23 OS=Oryza sativa subsp. japonica GN=RAD23 PE=1 SV=2)

HSP 1 Score: 222.631 bits (566), Expect = 1.908e-57
Identity = 110/155 (70.97%), Postives = 133/155 (85.81%), Query Frame = -1
Query:  226 SSGPNANPLDLFPQGLPDVGSGAAGAGSLDFLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVQG-GEGNLGDQLAGLMPQSIQVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHEFED 687
            SSGPNA+PLDLFPQ LP+  + AAG G+LD LRN+ QF+ L ++VQANPQ+LQP+LQELGKQNPQ+++LIQE+QA+FL LINEP +G  E NL DQ    MPQ+I VTPEE EAI RLEAMGFDRA+VL+VFFACNK+E+LAANYLLDHM+EF+D
Sbjct:  234 SSGPNASPLDLFPQALPNASTDAAGLGNLDALRNNAQFRTLLSLVQANPQILQPLLQELGKQNPQILQLIQENQAEFLHLINEPAEGDDEENLLDQFPEAMPQTIAVTPEENEAILRLEAMGFDRALVLDVFFACNKDEQLAANYLLDHMNEFDD 388          
BLAST of CF835585 vs. ExPASy Swiss-Prot
Match: RD23A_ARATH (Putative DNA repair protein RAD23-1 OS=Arabidopsis thaliana GN=RAD23-1 PE=2 SV=3)

HSP 1 Score: 200.29 bits (508), Expect = 1.014e-50
Identity = 100/156 (64.10%), Postives = 127/156 (81.41%), Query Frame = -1
Query:  226 SSGPNANPLDLFPQGLPDVGSGAAGAGSLDFLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVQG--GEGNLGDQLAGLMPQSIQVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHEFED 687
            S GPN++PLDLFPQ      +G+   G+L+FLRN+ QFQ LR MV +NPQ+LQPMLQELGKQNPQL+RLIQE+QA+FL+L+NEP +G  GEG++ DQ    MP +I VTP E+EAI+RLEAMGFDRA+V+E F AC++NEELAANYLL++  +FED
Sbjct:  217 SGGPNSSPLDLFPQETV-AAAGSGDLGTLEFLRNNDQFQQLRTMVHSNPQILQPMLQELGKQNPQLLRLIQENQAEFLQLVNEPYEGSDGEGDMFDQPEQEMPHAINVTPAEQEAIQRLEAMGFDRALVIEAFLACDRNEELAANYLLENSGDFED 371          
BLAST of CF835585 vs. ExPASy Swiss-Prot
Match: RD23B_ARATH (Putative DNA repair protein RAD23-2 OS=Arabidopsis thaliana GN=RAD23-2 PE=2 SV=2)

HSP 1 Score: 199.904 bits (507), Expect = 1.325e-50
Identity = 102/158 (64.56%), Postives = 129/158 (81.65%), Query Frame = -1
Query:  226 SSGPNANPLDLFPQGLPDVGSGAAGA--GSLDFLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVQGGEGNLG--DQLAGLMPQSIQVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHEFED 687
            S GPN++PLDLFPQ   +  S AAG   G+L+FLR + QFQ LR+MV +NPQ+LQPMLQELGKQNPQL+RLIQE+QA+FL+L+NEP +G +G++   DQ    MP S+ VTPEE+E+IERLEAMGFDRAIV+E F +C++NEELAANYLL+H  +FED
Sbjct:  214 SGGPNSSPLDLFPQ---EAVSDAAGGDLGTLEFLRGNDQFQQLRSMVNSNPQILQPMLQELGKQNPQLLRLIQENQAEFLQLLNEPYEGSDGDVDIFDQPDQEMPHSVNVTPEEQESIERLEAMGFDRAIVIEAFLSCDRNEELAANYLLEHSADFED 368          
BLAST of CF835585 vs. ExPASy Swiss-Prot
Match: RD23B_HUMAN (UV excision repair protein RAD23 homolog B OS=Homo sapiens GN=RAD23B PE=1 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 6.834e-31
Identity = 65/134 (48.51%), Postives = 95/134 (70.90%), Query Frame = -1
Query:  250 AAGAGSLDFLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVQ----------GGEGNLGDQLAGLMPQSIQVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLL 621
            ++G   L+FLRN PQFQ +R ++Q NP LL  +LQ++G++NPQL++ I +HQ  F++++NEPVQ          GG G + +  +G M   IQVTP+E+EAIERL+A+GF   +V++ +FAC KNE LAAN+LL
Sbjct:  270 SSGGHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHM-NYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLL 402          
BLAST of CF835585 vs. ExPASy Swiss-Prot
Match: RD23B_BOVIN (UV excision repair protein RAD23 homolog B OS=Bos taurus GN=RAD23B PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 8.926e-31
Identity = 65/134 (48.51%), Postives = 94/134 (70.15%), Query Frame = -1
Query:  250 AAGAGSLDFLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVQ----------GGEGNLGDQLAGLMPQSIQVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLL 621
            ++G   L+FLRN PQFQ +R ++Q NP LL  +LQ++G++NPQL++ I +HQ  F++++NEPVQ          GG G + +   G M   IQVTP+E+EAIERL+A+GF   +V++ +FAC KNE LAAN+LL
Sbjct:  269 SSGGHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGGGHM-NYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLL 401          
BLAST of CF835585 vs. ExPASy Swiss-Prot
Match: RD23B_RAT (UV excision repair protein RAD23 homolog B OS=Rattus norvegicus GN=Rad23b PE=1 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 7.556e-30
Identity = 65/139 (46.76%), Postives = 94/139 (67.63%), Query Frame = -1
Query:  250 AGAGSLDFLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVQ----------------GGEGNLGDQLAGLMPQSIQVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLL 618
            +G   L+FLRN PQFQ +R ++Q NP LL  +LQ++G++NPQL++ I +HQ  F++++NEPVQ                GG G + +  +G M   IQVTP+E+EAIERL+A+GF   +V++ +FAC KNE LAAN+LL
Sbjct:  271 SGGHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGGGGGGGGGGIAEAGSGHM-NYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLL 408          
BLAST of CF835585 vs. ExPASy Swiss-Prot
Match: RD23B_MOUSE (UV excision repair protein RAD23 homolog B OS=Mus musculus GN=Rad23b PE=1 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 9.869e-30
Identity = 65/140 (46.43%), Postives = 94/140 (67.14%), Query Frame = -1
Query:  250 AGAGSLDFLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVQ-----------------GGEGNLGDQLAGLMPQSIQVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLL 618
            +G   L+FLRN PQFQ +R ++Q NP LL  +LQ++G++NPQL++ I +HQ  F++++NEPVQ                 GG G + +  +G M   IQVTP+E+EAIERL+A+GF   +V++ +FAC KNE LAAN+LL
Sbjct:  271 SGGHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGGGGGGGGGGGIAEAGSGHM-NYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLL 409          
BLAST of CF835585 vs. ExPASy Swiss-Prot
Match: RD23A_MOUSE (UV excision repair protein RAD23 homolog A OS=Mus musculus GN=Rad23a PE=1 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 1.289e-29
Identity = 65/140 (46.43%), Postives = 96/140 (68.57%), Query Frame = -1
Query:  229 AAGAGSLDFLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLVRLIQEHQADFLRLINEP---------VQGGEGNLGDQLAGLMPQSIQVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHEFE 621
            AAG   L+FLR+ PQFQ +R ++Q NP LL  +LQ+LG++NPQL++ I  HQ  F++++NEP         V+G  G +G++   +    IQVTP+E+EAIERL+A+GF  ++V++ +FAC KNE LAAN+LL    + E
Sbjct:  226 AAGENPLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGEVGAIGEEAPQM--NYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDE 363          
The following BLAST results are available for this feature:
BLAST of CF835585 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
RD23D_ARATH5.173e-7173.26Putative DNA repair protein RAD23-4 OS=Arabidopsis... [more]
RD23C_ARATH8.258e-6974.48Putative DNA repair protein RAD23-3 OS=Arabidopsis... [more]
RAD23_ORYSJ1.908e-5770.97Probable DNA repair protein RAD23 OS=Oryza sativa ... [more]
RD23A_ARATH1.014e-5064.10Putative DNA repair protein RAD23-1 OS=Arabidopsis... [more]
RD23B_ARATH1.325e-5064.56Putative DNA repair protein RAD23-2 OS=Arabidopsis... [more]
RD23B_HUMAN6.834e-3148.51UV excision repair protein RAD23 homolog B OS=Homo... [more]
RD23B_BOVIN8.926e-3148.51UV excision repair protein RAD23 homolog B OS=Bos ... [more]
RD23B_RAT7.556e-3046.76UV excision repair protein RAD23 homolog B OS=Ratt... [more]
RD23B_MOUSE9.869e-3046.43UV excision repair protein RAD23 homolog B OS=Mus ... [more]
RD23A_MOUSE1.289e-2946.43UV excision repair protein RAD23 homolog A OS=Mus ... [more]

Pages

back to top
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS03_01I09_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01I09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835585 ID=CF835585|Name=CF835585|organism=Citrus sinensis|type=EST|length=786bp
TTTTTTTTTTTTTTTTTATGAGAAATTGAAGAATGTCCCTTTTTGCATTA
CTTGTTCACTCTCCACACATACCAAAGCATGAAATATCTGAACTTTGTTT
AACAAATGAAGTCGAGGAGAAATGAGAAGGGAAAGAAACTAATTAGAGGT
ATTTTTTAATAAATGCCGTCCAAAGGTAGTAACCATCATTTTCACCTTGA
ATCTTTTCTATTCCCCCTTCAATCAATCCTCAAACTCATGCATATGGTCT
AAAAGGTAGTTGGCAGCAAGTTCCTCATTCTTGTTGCAGGCAAAGAACAC
CTCCAATACAATTGCTCGATCAAAGCCCATTGCCTCAAGACGTTCTATGG
CTTCACGTTCTTCGGGCGTGACTTGTATTGACTGTGGCATTAACCCAGCA
AGCTGGTCCCCCAAATTCCCCTCACCACCTTGAACAGGTTCATTGATAAG
CCGAAGGAAGTCAGCCTGATGTTCCTGAATAAGCCTCACTAGCTGAGGAT
TTTGTTTCCCCAACTCTTGAAGCATGGGCTGCAATAATTGAGGATTTGCC
TGCACCATAGCTCGCAAAACTTGAAACTGTGGACTATTACGTAAAAAGTC
AAGACTGCCAGCGCCAGCTGCACCTGAACCCACGTCAGGAAGGCCCTGAG
GAAAGAGGTCCAAAGGATTTGCATTTGGCCCACTAGAAGTAACGGGTGCC
GGTTGGGTTGGCTGTGGCATCTGAGTTGGAGAGTTAGCAGCTTGTCCATT
ACCAGGGGCGCGGGCCACAGGTTGAACTTCAGCTTG
back to top