CF835718

Overview
NameCF835718
Unique NameCF835718
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length705
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13467 contig Csv1_Contig13467:165..869. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835718 vs. ExPASy Swiss-Prot
Match: RUBB_ARATH (RuBisCO large subunit-binding protein subunit beta, chloroplastic OS=Arabidopsis thaliana GN=At1g55490 PE=1 SV=3)

HSP 1 Score: 189.504 bits (480), Expect = 1.498e-47
Identity = 98/115 (85.22%), Postives = 101/115 (87.83%), Query Frame = -1
Query:  361 LDNDEEKVGADIVKRALCYPLKLIAKNPGVNGSVVSEKVLSRANHKYGSNAATGNYEDLMAAGIIDPPKVVRCCLEHASSGAKTFLMSDCGGVEIKEPEPAMPGGNPMANSGYGY 705
            LDNDEEKVGADIVKRAL YPLKLIAKN GVNGSVVSEKVLS  N K+G NAATG YEDLMAAGIIDP KVVRCCLEHA+S AKTFLMSDC  VEIKEPEP +P GNPM NSGYGY
Sbjct:  487 LDNDEEKVGADIVKRALSYPLKLIAKNAGVNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSDCVVVEIKEPEP-VPVGNPMDNSGYGY 600          
BLAST of CF835718 vs. ExPASy Swiss-Prot
Match: RUBB_PEA (RuBisCO large subunit-binding protein subunit beta, chloroplastic OS=Pisum sativum PE=1 SV=2)

HSP 1 Score: 184.496 bits (467), Expect = 4.820e-46
Identity = 98/114 (85.96%), Postives = 98/114 (85.96%), Query Frame = -1
Query:  364 LDNDEEKVGADIVKRALCYPLKLIAKNPGVNGSVVSEKVLSRANHKYGSNAATGNYEDLMAAGIIDPPKVVRCCLEHASSGAKTFLMSDCGGVEIKEPEPAMPGGNPMANSGYG 705
            L NDEEKVGADIVKRAL YPLKLIAKN GVNGSVVSEKVLS  N KYG NAATG YEDLMAAGIIDP KVVRCCLEHASS AKTFLMSDC  VEIKEPE A P GNPM NSGYG
Sbjct:  481 LANDEEKVGADIVKRALSYPLKLIAKNAGVNGSVVSEKVLSSDNPKYGYNAATGKYEDLMAAGIIDPTKVVRCCLEHASSVAKTFLMSDCVVVEIKEPESA-PVGNPMDNSGYG 593          
BLAST of CF835718 vs. ExPASy Swiss-Prot
Match: RUBB_SECCE (RuBisCO large subunit-binding protein subunit beta, chloroplastic (Fragment) OS=Secale cereale GN=CPN60 PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 2.924e-43
Identity = 90/115 (78.26%), Postives = 98/115 (85.22%), Query Frame = -1
Query:  361 LDNDEEKVGADIVKRALCYPLKLIAKNPGVNGSVVSEKVLSRANHKYGSNAATGNYEDLMAAGIIDPPKVVRCCLEHASSGAKTFLMSDCGGVEIKEPEPAMPGGNPMANSGYGY 705
            L+NDE+KVGA+IV+RALCYPLKLIAKN GVNGSVV+EKVLS  N K+G NAATG YEDLMAAGIIDP KVVRCCLEHA+S AKTFL SD   VEIKEPE A P  NPM NSG+GY
Sbjct:  386 LENDEQKVGAEIVRRALCYPLKLIAKNAGVNGSVVTEKVLSNDNFKFGYNAATGQYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSDVVVVEIKEPE-AAPLANPMDNSGFGY 499          
BLAST of CF835718 vs. ExPASy Swiss-Prot
Match: RUBB_BRANA (RuBisCO large subunit-binding protein subunit beta, chloroplastic OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.229e-41
Identity = 87/100 (87.00%), Postives = 89/100 (89.00%), Query Frame = -1
Query:  406 LDNDEEKVGADIVKRALCYPLKLIAKNPGVNGSVVSEKVLSRANHKYGSNAATGNYEDLMAAGIIDPPKVVRCCLEHASSGAKTFLMSDCGGVEIKEPEP 705
            LDNDEEKVGADIVKRAL YPLKLIAKN GVNGSVVSEKVLS  N K+G NAATG YEDLMAAGIIDP KVVRCCLEHA+S AKTFLMSDC  VEIKEPEP
Sbjct:  487 LDNDEEKVGADIVKRALSYPLKLIAKNAGVNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSDCVVVEIKEPEP 586          
BLAST of CF835718 vs. ExPASy Swiss-Prot
Match: RUBC_CHLRE (RuBisCO large subunit-binding protein subunit beta-2 (Fragment) OS=Chlamydomonas reinhardtii PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.116e-26
Identity = 65/111 (58.56%), Postives = 79/111 (71.17%), Query Frame = -1
Query:  388 LDNDEEKVGADIVKRALCYPLKLIAKNPGVNGSVVSEKVLSRANHKY-GSNAATGNYEDLMAAGIIDPPKVVRCCLEHASSGAKTFLMSDCGGVEI----KEPEPAMPGGN 705
            L N+E+K+GADI+KRAL YP+KLIA N G NGSVV ++V+   +  Y G NAAT  +EDLM AGIIDP KVVRC LE+A S AKTFL++D    EI    K P PA  GG+
Sbjct:  148 LSNEEQKMGADIIKRALSYPIKLIANNAGTNGSVVMQRVMDNIDQPYYGYNAATDTFEDLMEAGIIDPTKVVRCSLENAVSVAKTFLLADVVVTEIPEKEKAPAPAAGGGD 258          
BLAST of CF835718 vs. ExPASy Swiss-Prot
Match: RUBB_CHLRE (RuBisCO large subunit-binding protein subunit beta-1 (Fragment) OS=Chlamydomonas reinhardtii PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 2.750e-25
Identity = 60/111 (54.05%), Postives = 79/111 (71.17%), Query Frame = -1
Query:  394 LDNDEEKVGADIVKRALCYPLKLIAKNPGVNGSVVSEKVLSRANHK-YGSNAATGNYEDLMAAGIIDPPKVVRCCLEHASSGAKTFLMSDCGGVEIKE------PEPAMPG 705
            + + E+++GADI+KRALCYP+KLIA+N GVNGSVV  +V+   +   YG NAAT ++E+LM  GIIDP KVVRC +E+A S AKTFL++D    E+KE      P P  PG
Sbjct:  317 MTDPEQQMGADIIKRALCYPIKLIAQNAGVNGSVVMNEVMKNLDRPHYGYNAATDSFENLMETGIIDPSKVVRCSMENAVSVAKTFLLADVVVTELKEIEAGAKPNPVAPG 427          
BLAST of CF835718 vs. ExPASy Swiss-Prot
Match: CH60_COXBU (60 kDa chaperonin OS=Coxiella burnetii GN=groL PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 9.153e-21
Identity = 49/113 (43.36%), Postives = 74/113 (65.49%), Query Frame = -1
Query:  370 LDNDEEKVGADIVKRALCYPLKLIAKNPGVNGSVVSEKVLSRANHKYGSNAATGNYEDLMAAGIIDPPKVVRCCLEHASSGAKTFLMSDCGGVEI-KEPEPAMPGGNPMANSG 705
            ++N++++VG +I +RA+ YPL  I KN GV  +VV++KVL+  +  YG NAATG Y D++  GI+DP KV R  L++A+S A   + ++C   E  K+ E +MPGG  M   G
Sbjct:  431 VENEDQRVGVEIARRAMAYPLSQIVKNTGVQAAVVADKVLNHKDVNYGYNAATGEYGDMIEMGILDPTKVTRTALQNAASIAGLMITTECMVTEAPKKKEESMPGGGDMGGMG 543          
BLAST of CF835718 vs. ExPASy Swiss-Prot
Match: CH60_COXBR (60 kDa chaperonin OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=groL PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 9.153e-21
Identity = 49/113 (43.36%), Postives = 74/113 (65.49%), Query Frame = -1
Query:  370 LDNDEEKVGADIVKRALCYPLKLIAKNPGVNGSVVSEKVLSRANHKYGSNAATGNYEDLMAAGIIDPPKVVRCCLEHASSGAKTFLMSDCGGVEI-KEPEPAMPGGNPMANSG 705
            ++N++++VG +I +RA+ YPL  I KN GV  +VV++KVL+  +  YG NAATG Y D++  GI+DP KV R  L++A+S A   + ++C   E  K+ E +MPGG  M   G
Sbjct:  431 VENEDQRVGVEIARRAMAYPLSQIVKNTGVQAAVVADKVLNHKDVNYGYNAATGEYGDMIEMGILDPTKVTRTALQNAASIAGLMITTECMVTEAPKKKEESMPGGGDMGGMG 543          
BLAST of CF835718 vs. ExPASy Swiss-Prot
Match: CH60_COXBN (60 kDa chaperonin OS=Coxiella burnetii (strain Dugway 5J108-111) GN=groL PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 9.153e-21
Identity = 49/113 (43.36%), Postives = 74/113 (65.49%), Query Frame = -1
Query:  370 LDNDEEKVGADIVKRALCYPLKLIAKNPGVNGSVVSEKVLSRANHKYGSNAATGNYEDLMAAGIIDPPKVVRCCLEHASSGAKTFLMSDCGGVEI-KEPEPAMPGGNPMANSG 705
            ++N++++VG +I +RA+ YPL  I KN GV  +VV++KVL+  +  YG NAATG Y D++  GI+DP KV R  L++A+S A   + ++C   E  K+ E +MPGG  M   G
Sbjct:  431 VENEDQRVGVEIARRAMAYPLSQIVKNTGVQAAVVADKVLNHKDVNYGYNAATGEYGDMIEMGILDPTKVTRTALQNAASIAGLMITTECMVTEAPKKKEESMPGGGDMGGMG 543          
BLAST of CF835718 vs. ExPASy Swiss-Prot
Match: CH60_COXB2 (60 kDa chaperonin OS=Coxiella burnetii (strain CbuG_Q212) GN=groL PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 9.153e-21
Identity = 49/113 (43.36%), Postives = 74/113 (65.49%), Query Frame = -1
Query:  370 LDNDEEKVGADIVKRALCYPLKLIAKNPGVNGSVVSEKVLSRANHKYGSNAATGNYEDLMAAGIIDPPKVVRCCLEHASSGAKTFLMSDCGGVEI-KEPEPAMPGGNPMANSG 705
            ++N++++VG +I +RA+ YPL  I KN GV  +VV++KVL+  +  YG NAATG Y D++  GI+DP KV R  L++A+S A   + ++C   E  K+ E +MPGG  M   G
Sbjct:  431 VENEDQRVGVEIARRAMAYPLSQIVKNTGVQAAVVADKVLNHKDVNYGYNAATGEYGDMIEMGILDPTKVTRTALQNAASIAGLMITTECMVTEAPKKKEESMPGGGDMGGMG 543          
The following BLAST results are available for this feature:
BLAST of CF835718 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RUBB_ARATH1.498e-4785.22RuBisCO large subunit-binding protein subunit beta... [more]
RUBB_PEA4.820e-4685.96RuBisCO large subunit-binding protein subunit beta... [more]
RUBB_SECCE2.924e-4378.26RuBisCO large subunit-binding protein subunit beta... [more]
RUBB_BRANA1.229e-4187.00RuBisCO large subunit-binding protein subunit beta... [more]
RUBC_CHLRE1.116e-2658.56RuBisCO large subunit-binding protein subunit beta... [more]
RUBB_CHLRE2.750e-2554.05RuBisCO large subunit-binding protein subunit beta... [more]
CH60_COXBU9.153e-2143.3660 kDa chaperonin OS=Coxiella burnetii GN=groL PE=... [more]
CH60_COXBR9.153e-2143.3660 kDa chaperonin OS=Coxiella burnetii (strain RSA... [more]
CH60_COXBN9.153e-2143.3660 kDa chaperonin OS=Coxiella burnetii (strain Dug... [more]
CH60_COXB29.153e-2143.3660 kDa chaperonin OS=Coxiella burnetii (strain Cbu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01M06_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01M06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835718 ID=CF835718|Name=CF835718|organism=Citrus sinensis|type=EST|length=705bp
TTTTTTTTTTTTTTTTTCTTTAAAGTCCAGACCAAGAGTTATAACATTTA
AGCTCCCCTAACAGGGAACAGTAACAAATGGGAGTACCCCCAAAATTAAT
ATCAAACTGGGAAGGAGATGAGCAAAATAAAATTTCTTTCCCTCAAAAAG
TTCAAAATCATTGCAATGGGACATCTAATTGCAAATTAATACGAGCCGTA
CTCTGGCAAGCTATCCTCCCCAAAATCCATAAACTCTACTAAGTCGAGTA
ATTGAATTTACAAAAAAAAAAAAACCCAACGCTGGCAAACTGAAAAATAG
TTGCTATAACGAAGTCAAAACCTTATTTGCTTGCCCCCCGGGACCTTGTT
AATTAGCTTAGTATCCATATCCTGAGTTGGCCATAGGGTTACCCCCAGGC
ATAGCGGGTTCAGGCTCCTTGATCTCAACCCCCCCACAGTCGGACATCAA
GAAGGTTTTTGCCCCCGAGGAAGCATGCTCCAAGCAACATCTAACCACCT
TGGGAGGATCAATAATTCCTGCAGCCATTAAATCTTCGTAGTTTCCAGTT
GCAGCATTGGATCCATATTTATGATTGGCCCTTGAAAGCACCTTCTCGCT
GACCACACTTCCATTAACACCGGGATTTTTGGCAATTAATTTCAGGGGGT
AGCACAGAGCTCTTTTAACAATATCTGCTCCAACCTTTTCTTCATCATTA
TCAAG
back to top