CF836203
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF836203 vs. ExPASy Swiss-Prot
Match: RL291_ARATH (60S ribosomal protein L29-1 OS=Arabidopsis thaliana GN=RPL29A PE=1 SV=1) HSP 1 Score: 107.071 bits (266), Expect = 2.970e-23 Identity = 48/60 (80.00%), Postives = 54/60 (90.00%), Query Frame = 3 Query: 45 MALSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQGGESAAEE 224 MA SKNHTAHNQS KAHKNGIKKP++HRHT T+GMDPKFLRNQRYARKHN + GE+A+ E Sbjct: 1 MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVKAGENASAE 60
BLAST of CF836203 vs. ExPASy Swiss-Prot
Match: RL292_ARATH (60S ribosomal protein L29-2 OS=Arabidopsis thaliana GN=RPL29B PE=2 SV=2) HSP 1 Score: 106.301 bits (264), Expect = 5.066e-23 Identity = 48/60 (80.00%), Postives = 53/60 (88.33%), Query Frame = 3 Query: 45 MALSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQGGESAAEE 224 MA SKNHTAHNQS KAHKNGIKKP++HRHT T+GMDPKFLRNQRYARKHN + GE+A E Sbjct: 1 MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVKSGENAGVE 60
BLAST of CF836203 vs. ExPASy Swiss-Prot
Match: RL29_RAT (60S ribosomal protein L29 OS=Rattus norvegicus GN=Rpl29 PE=1 SV=3) HSP 1 Score: 84.7297 bits (208), Expect = 1.578e-16 Identity = 37/53 (69.81%), Postives = 44/53 (83.02%), Query Frame = 3 Query: 45 MALSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQG 203 MA SKNHT HNQS K H+NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK+G Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKG 53
BLAST of CF836203 vs. ExPASy Swiss-Prot
Match: RL29_PIG (60S ribosomal protein L29 OS=Sus scrofa GN=RPL29 PE=2 SV=4) HSP 1 Score: 84.7297 bits (208), Expect = 1.578e-16 Identity = 37/53 (69.81%), Postives = 44/53 (83.02%), Query Frame = 3 Query: 45 MALSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQG 203 MA SKNHT HNQS K H+NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK+G Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKG 53
BLAST of CF836203 vs. ExPASy Swiss-Prot
Match: RL29_MOUSE (60S ribosomal protein L29 OS=Mus musculus GN=Rpl29 PE=2 SV=2) HSP 1 Score: 84.7297 bits (208), Expect = 1.578e-16 Identity = 37/53 (69.81%), Postives = 44/53 (83.02%), Query Frame = 3 Query: 45 MALSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQG 203 MA SKNHT HNQS K H+NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK+G Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKG 53
BLAST of CF836203 vs. ExPASy Swiss-Prot
Match: RL29_MACFA (60S ribosomal protein L29 OS=Macaca fascicularis GN=RPL29 PE=2 SV=3) HSP 1 Score: 84.7297 bits (208), Expect = 1.578e-16 Identity = 37/53 (69.81%), Postives = 44/53 (83.02%), Query Frame = 3 Query: 45 MALSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQG 203 MA SKNHT HNQS K H+NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK+G Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKG 53
BLAST of CF836203 vs. ExPASy Swiss-Prot
Match: RL29_HUMAN (60S ribosomal protein L29 OS=Homo sapiens GN=RPL29 PE=1 SV=2) HSP 1 Score: 84.7297 bits (208), Expect = 1.578e-16 Identity = 37/53 (69.81%), Postives = 44/53 (83.02%), Query Frame = 3 Query: 45 MALSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQG 203 MA SKNHT HNQS K H+NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK+G Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKG 53
BLAST of CF836203 vs. ExPASy Swiss-Prot
Match: RL29_BOVIN (60S ribosomal protein L29 OS=Bos taurus GN=RPL29 PE=2 SV=3) HSP 1 Score: 84.7297 bits (208), Expect = 1.578e-16 Identity = 37/53 (69.81%), Postives = 44/53 (83.02%), Query Frame = 3 Query: 45 MALSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQG 203 MA SKNHT HNQS K H+NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK+G Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKG 53
BLAST of CF836203 vs. ExPASy Swiss-Prot
Match: RL29_DROME (60S ribosomal protein L29 OS=Drosophila melanogaster GN=RpL29 PE=1 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 2.520e-14 Identity = 38/56 (67.86%), Postives = 42/56 (75.00%), Query Frame = 3 Query: 45 MALSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQGGES 212 MA SKNHT HNQ+ KAH+NGIK+P + RH ST GMD KFL NQRYARK N ES Sbjct: 1 MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREES 56
BLAST of CF836203 vs. ExPASy Swiss-Prot
Match: RL29_YEAST (60S ribosomal protein L29 OS=Saccharomyces cerevisiae GN=RPL29 PE=1 SV=3) HSP 1 Score: 71.633 bits (174), Expect = 1.383e-12 Identity = 31/46 (67.39%), Postives = 39/46 (84.78%), Query Frame = 3 Query: 45 MALSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYA 182 MA SKNHTAHNQ+ KAH+NGIKKPK +++ S KG+DPKF RN ++A Sbjct: 1 MAKSKNHTAHNQTRKAHRNGIKKPKTYKYPSLKGVDPKFRRNHKHA 46 The following BLAST results are available for this feature:
BLAST of CF836203 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 11
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF836203 ID=CF836203; Name=CF836203; organism=Citrus sinensis; type=EST; length=404bpback to top |