CK933033

Overview
NameCK933033
Unique NameCK933033
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length692
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK933033_ssr63 microsatellite CK933033_ssr63:63..78. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7909 contig Csv1_Contig7909:264..955. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933033 vs. ExPASy Swiss-Prot
Match: PSAEA_NICSY (Photosystem I reaction center subunit IV A, chloroplastic OS=Nicotiana sylvestris GN=PSAEA PE=1 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.705e-32
Identity = 82/144 (56.94%), Postives = 92/144 (63.89%), Query Frame = 3
Query:   84 MASCNMASAASGFSL-TPNVATNVNSGSKSNMLFFPPKNNSSNSFRLVVRASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKILRRESYWYNGIGSVVAVDQDPKSRYPVVVRFNKVNYANVSTNNYALDEIEEVK 512
            MASCNMASAAS F + TPNVA+N N+ S++ MLFF  KN  S + RLVVRA+                                    V+ILR+ESYWY G GSVVA DQDP +RYPVVVRFNKVNYANVSTNNYALDEIEEVK
Sbjct:    1 MASCNMASAASNFLVATPNVASNTNT-SRTTMLFFSSKNYGSTAPRLVVRAAEEAAPPAAAATAEPAEAPVKAAKPPPIGPKRGTK--VRILRKESYWYKGTGSVVACDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIEEVK 141          
BLAST of CK933033 vs. ExPASy Swiss-Prot
Match: PSAEB_NICSY (Photosystem I reaction center subunit IV B, chloroplastic OS=Nicotiana sylvestris GN=PSAEB PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 9.357e-31
Identity = 79/146 (54.11%), Postives = 97/146 (66.44%), Query Frame = 3
Query:   84 MASCNMASAASGFSL-TPNVATNVNSGSKSNMLFFPP-KNNSSNSF-RLVVRASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKILRRESYWYNGIGSVVAVDQDPKSRYPVVVRFNKVNYANVSTNNYALDEIEEVK 512
            MAS +MASAASGF + TPN+AT+ N+  +++MLFF   KNN++ +F RLVVRA+                                    V++LR+ESYWY G+GSVVAVDQDP +RYPVVVRFNKVNYANVSTNNYALDE+EEVK
Sbjct:    1 MASSSMASAASGFMVATPNIATS-NTAPRTSMLFFSSSKNNTTTNFPRLVVRAAEEAAPPAATATAEGEAPPAKAAKPPPIGPKRGTK--VRVLRKESYWYKGVGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEEVK 143          
BLAST of CK933033 vs. ExPASy Swiss-Prot
Match: PSAE2_ARATH (Photosystem I reaction center subunit IV B, chloroplastic OS=Arabidopsis thaliana GN=PSAE2 PE=1 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 2.915e-24
Identity = 69/146 (47.26%), Postives = 81/146 (55.48%), Query Frame = 3
Query:   99 MASAASGFSLTPNVATNVNSGSKSN---MLFFPPKNNSSNSFRLVVRASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----VKILRRESYWYNGIGSVVAVDQDPKSRYPVVVRFNKVNYANVSTNNYALDEIEEVK 512
            M SAA+GF LT NV   +  GS  +   + F P ++  S   RLVVRA+                                         VKILR+ESYWY  +GSVVAVDQDPK+RYPVVVRF KVNYAN+STNNYALDE+EEVK
Sbjct:    3 MTSAATGFILTANVPAAIGGGSSKSTTIVSFLPMRSFGS---RLVVRAAEDTPPATASSDSSSTTAAAAPAKVPAAKAKPPPIGPKRGSKVKILRKESYWYKNVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEVEEVK 145          
BLAST of CK933033 vs. ExPASy Swiss-Prot
Match: PSAE_HORVU (Photosystem I reaction center subunit IV, chloroplastic OS=Hordeum vulgare GN=PSAE PE=1 SV=2)

HSP 1 Score: 110.538 bits (275), Expect = 8.483e-24
Identity = 68/148 (45.95%), Postives = 77/148 (52.03%), Query Frame = 3
Query:   84 MASCNMASAASGFSLTPNVATNVNSGSKSNMLFFPPKNNSSNSFRLVVRA------SXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKILRRESYWYNGIGSVVAVDQDPKSRYPVVVRFNKVNYANVSTNNYALDEIEEV 509
            MAS NMASA S F L   + +  N G  S + F P   ++    +LV RA      +                                    VKILRRESYWYNG GSVV VDQDP +RYPVVVRF KVNYA VSTNNYALDEI+EV
Sbjct:    1 MASTNMASATSRFMLAAGIPSGANGGVSSRVSFLP---SNRLGLKLVARAEEPTAAAPAEPAPAADEKPEAAVATKEPAKAKPPPRGPKRGTKVKILRRESYWYNGTGSVVTVDQDPNTRYPVVVRFAKVNYAGVSTNNYALDEIKEV 145          
BLAST of CK933033 vs. ExPASy Swiss-Prot
Match: PSAE_SPIOL (Photosystem I reaction center subunit IV, chloroplastic OS=Spinacia oleracea GN=PSAE-1 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.600e-22
Identity = 48/55 (87.27%), Postives = 54/55 (98.18%), Query Frame = 3
Query:  345 VKILRRESYWYNGIGSVVAVDQDPKSRYPVVVRFNKVNYANVSTNNYALDEIEEV 509
            V+I+R+ESYWY G+GSVVAVDQDPK+RYPVVVRFNKVNYANVSTNNYALDEI+EV
Sbjct:   70 VRIMRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIQEV 124          
BLAST of CK933033 vs. ExPASy Swiss-Prot
Match: PSAE1_ARATH (Photosystem I reaction center subunit IV A, chloroplastic OS=Arabidopsis thaliana GN=PSAE1 PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.089e-22
Identity = 66/142 (46.48%), Postives = 80/142 (56.34%), Query Frame = 3
Query:   99 MASAASGFSLTPNVATNVN-SGSKSNMLFFPPKNNSSNSFRLVVRASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX----VKILRRESYWYNGIGSVVAVDQDPKSRYPVVVRFNKVNYANVSTNNYALDEIEEV 509
            M +A++ F L  NV +    S S+S++ F P +N  S   RLVVRA+                                        VKILRRESYW+  +GSVVAVDQDPK+RYPVVVRF KVNYAN+STNNYALDE+EEV
Sbjct:    3 MTTASTVFVLPANVTSVAGASSSRSSVSFLPMRNAGS---RLVVRAAEDPAPASSSSKDSPAAAAAPDGATATKPKPPPIGPKRGSKVKILRRESYWFKNVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEVEEV 141          
BLAST of CK933033 vs. ExPASy Swiss-Prot
Match: PSAE_THEEB (Photosystem I reaction center subunit IV OS=Thermosynechococcus elongatus (strain BP-1) GN=psaE PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 2.315e-13
Identity = 36/62 (58.06%), Postives = 47/62 (75.81%), Query Frame = 3
Query:  345 VKILRRESYWYNGIGSVVAVDQDPKSRYPVVVRFNKVNY-------ANVSTNNYALDEIEEV 509
            VKILR ESYWYN +G+V +VDQ P  +YPV+VRF+KVNY       + V+TNN+AL E++EV
Sbjct:    8 VKILRPESYWYNEVGTVASVDQTPGVKYPVIVRFDKVNYTGYSGSASGVNTNNFALHEVQEV 69          
BLAST of CK933033 vs. ExPASy Swiss-Prot
Match: PSAE_SYNEN (Photosystem I reaction center subunit IV OS=Synechococcus elongatus naegeli GN=psaE PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 2.315e-13
Identity = 36/62 (58.06%), Postives = 47/62 (75.81%), Query Frame = 3
Query:  345 VKILRRESYWYNGIGSVVAVDQDPKSRYPVVVRFNKVNY-------ANVSTNNYALDEIEEV 509
            VKILR ESYWYN +G+V +VDQ P  +YPV+VRF+KVNY       + V+TNN+AL E++EV
Sbjct:    8 VKILRPESYWYNEVGTVASVDQTPGVKYPVIVRFDKVNYTGYSGSASGVNTNNFALHEVQEV 69          
BLAST of CK933033 vs. ExPASy Swiss-Prot
Match: PSAE_GLOVI (Photosystem I reaction center subunit IV OS=Gloeobacter violaceus GN=psaE PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.024e-13
Identity = 31/56 (55.36%), Postives = 45/56 (80.36%), Query Frame = 3
Query:  345 VKILRRESYWYNGIGSVVAVDQDPKSRYPVVVRFNKVNYANVSTNNYALDEIEEVK 512
            V+ILR+ESYWY  +G+V +VD+  K+ YPV VRF KVNY+ ++TNN+ + E+EEV+
Sbjct:    9 VRILRKESYWYREVGTVASVDKSEKTIYPVTVRFEKVNYSGINTNNFGVSELEEVE 64          
BLAST of CK933033 vs. ExPASy Swiss-Prot
Match: PSAE_CYAPA (Photosystem I reaction center subunit IV OS=Cyanophora paradoxa GN=psaE PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 5.158e-13
Identity = 33/56 (58.93%), Postives = 47/56 (83.93%), Query Frame = 3
Query:  345 VKILRRESYWYNGIGSVVAVDQDPKSRYPVVVRFNKVNYANVSTNNYALDEIEEVK 512
            V+ILR+ESYWY  IG+V ++DQ    +YPV+VRF KVNY+NV++NN++LDE+ EV+
Sbjct:    8 VRILRKESYWYQEIGTVASIDQSG-IKYPVIVRFEKVNYSNVNSNNFSLDEVVEVE 62          
The following BLAST results are available for this feature:
BLAST of CK933033 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 21
Match NameE-valueIdentityDescription
PSAEA_NICSY1.705e-3256.94Photosystem I reaction center subunit IV A, chloro... [more]
PSAEB_NICSY9.357e-3154.11Photosystem I reaction center subunit IV B, chloro... [more]
PSAE2_ARATH2.915e-2447.26Photosystem I reaction center subunit IV B, chloro... [more]
PSAE_HORVU8.483e-2445.95Photosystem I reaction center subunit IV, chloropl... [more]
PSAE_SPIOL1.600e-2287.27Photosystem I reaction center subunit IV, chloropl... [more]
PSAE1_ARATH2.089e-2246.48Photosystem I reaction center subunit IV A, chloro... [more]
PSAE_THEEB2.315e-1358.06Photosystem I reaction center subunit IV OS=Thermo... [more]
PSAE_SYNEN2.315e-1358.06Photosystem I reaction center subunit IV OS=Synech... [more]
PSAE_GLOVI3.024e-1355.36Photosystem I reaction center subunit IV OS=Gloeob... [more]
PSAE_CYAPA5.158e-1358.93Photosystem I reaction center subunit IV OS=Cyanop... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit juice sac at 38 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004348_E01 Developing fruit juice sac at 38 DAFB Citrus sinensis cDNA clone JSJune0004_IIF_E01 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933033 ID=CK933033|Name=CK933033|organism=Citrus sinensis|type=EST|length=692bp
GGGGACTGTCCTTTTGCACATTTTATTTTCTGCAACTCTCTCCCCAGTTA
AACAGAAACAGCGAAAGAAAGAAAGAAAAAGTGATGGCTAGCTGCAACAT
GGCATCAGCTGCTTCTGGGTTTTCGCTGACACCCAATGTTGCGACCAATG
TAAACTCAGGTTCCAAGAGCAACATGCTGTTTTTCCCTCCAAAGAACAAC
AGCTCCAACAGTTTCAGGCTTGTTGTACGGGCTTCTGAGGAGGCTGCTGC
CCCGCCGGCTGCTGCCACCACCGCTGCCCCAGCTGAAGGTGAAGCAGCTC
CCAAGCCCAAGCCACCTCCGATTGGACCCAAGAGAGGCGCCAAGGTTAAG
ATTCTCAGGAGGGAGTCCTACTGGTACAATGGCATTGGGTCTGTGGTTGC
TGTTGACCAGGATCCCAAGAGTCGGTACCCAGTTGTGGTTCGATTCAACA
AGGTTAACTATGCAAATGTATCAACGAACAACTATGCATTGGATGAGATC
GAAGAAGTTAAATGAGTTATGTAATTTGGATTTGCATATTATTCCCCGCT
CTAGATTAAGCCTTTGTGTGCCAGGAATGTGTATTCTATTCTCCAAGTGA
ATTCTTCTTCTGTCTACTTCGCCATCATGTTTATGCTTATCCAACGAAAA
GATGTTCACAACTTGAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top