CK933919
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK933919 vs. ExPASy Swiss-Prot
Match: FTRV_MAIZE (Ferredoxin-thioredoxin reductase, variable chain OS=Zea mays PE=1 SV=1) HSP 1 Score: 107.071 bits (266), Expect = 1.248e-22 Identity = 47/80 (58.75%), Postives = 65/80 (81.25%), Query Frame = 2 Query: 377 KIGAKVKVKVPLKVYHVPRVPEHDLSGMEGVLKQYVGVWKGKKISANMPYKVAFVTEIEG--RPVKFFAHLKEDEFDYLD 610 KIG +V+V PL+VYHV + P+ D+ GMEGV+KQYV VWKGK+++AN P+KV F +EG +PV+FFAHL+EDEF+++D Sbjct: 17 KIGRRVRVTAPLRVYHVLKAPDLDIQGMEGVVKQYVCVWKGKRVTANFPFKVEFELAVEGQPKPVRFFAHLREDEFEFVD 96
BLAST of CK933919 vs. ExPASy Swiss-Prot
Match: FTRV_SPIOL (Ferredoxin-thioredoxin reductase, variable chain, chloroplastic OS=Spinacia oleracea GN=FTRV PE=1 SV=2) HSP 1 Score: 96.6709 bits (239), Expect = 1.687e-19 Identity = 54/115 (46.96%), Postives = 71/115 (61.74%), Query Frame = 2 Query: 269 ISCEVAVKSNNSTASVGLEXXXXXXXXXXDDGFDESKIGAKVKVKVPLKVYHVPRVPEHDLS-GMEGVLKQYVGVWKGKKISANMPYKVAFVTEIEGR-PVKFFAHLKEDEFDYL 607 I CEVA+KS++ST + K+G KVKVK PLKVYHVP++PE +L+ M GV+KQYVG WKGK IS N P+KV + ++ R VK HLKE+EF+ + Sbjct: 60 ICCEVALKSDSSTGFDSSSSSPPEEDEELKKNLE--KVGCKVKVKSPLKVYHVPKLPEVELTPDMVGVIKQYVGFWKGKYISPNYPFKVEYRIDVPDRGSVKLVVHLKEEEFEII 172 The following BLAST results are available for this feature:
BLAST of CK933919 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CK933919 ID=CK933919; Name=CK933919; organism=Citrus sinensis; type=EST; length=818bpback to top |