CK935716
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CK935716 vs. ExPASy Swiss-Prot
Match: DS22_CRAPL (Desiccation stress protein DSP-22, chloroplastic OS=Craterostigma plantagineum GN=DSP-22 PE=2 SV=1) HSP 1 Score: 83.9593 bits (206), Expect = 2.666e-16 Identity = 38/58 (65.52%), Postives = 50/58 (86.21%), Query Frame = 2 Query: 8 TSALLTVASLVPXXKGASVESKSDGFXXSDAELWNGRFAMLGLVALAFTEFVKGGTLV 181 TSA+L +A+L+P +G S E+K++GF SDAE+WNGRFAM+GLVALAFTE+VKGG L+ Sbjct: 140 TSAVLVLATLIPIYRGLSPEAKNNGFWNSDAEIWNGRFAMIGLVALAFTEYVKGGPLI 197
BLAST of CK935716 vs. ExPASy Swiss-Prot
Match: ELI_PEA (Early light-induced protein, chloroplastic OS=Pisum sativum PE=2 SV=1) HSP 1 Score: 83.5741 bits (205), Expect = 3.482e-16 Identity = 42/59 (71.19%), Postives = 47/59 (79.66%), Query Frame = 2 Query: 5 GTSALLTVASLVPXXKGASVESKSDGFXXSDAELWNGRFAMLGLVALAFTEFVKGGTLV 181 GTS LL++ASL+P +G SVESKS SDAE WNGR AMLGLVALAFTEFVKG +LV Sbjct: 138 GTSVLLSLASLIPFFQGVSVESKSKSIMSSDAEFWNGRIAMLGLVALAFTEFVKGTSLV 196
BLAST of CK935716 vs. ExPASy Swiss-Prot
Match: ELI5_HORVU (High molecular mass early light-inducible protein HV58, chloroplastic OS=Hordeum vulgare PE=2 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 9.483e-14 Identity = 37/58 (63.79%), Postives = 44/58 (75.86%), Query Frame = 2 Query: 8 TSALLTVASLVPXXKGASVESKSDGFXXSDAELWNGRFAMLGLVALAFTEFVKGGTLV 181 T+ + +VASL+P +G SVESKS G +DAELWNGRFAMLGLVALA TEF+ G V Sbjct: 172 TAGVFSVASLLPLLQGQSVESKSSGIWSADAELWNGRFAMLGLVALAATEFITGAPFV 229 The following BLAST results are available for this feature:
BLAST of CK935716 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CK935716 ID=CK935716; Name=CK935716; organism=Citrus sinensis; type=EST; length=333bpback to top |