FK826648
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of FK826648 vs. ExPASy Swiss-Prot
Match: ACLY_DICDI (Probable ATP-citrate synthase OS=Dictyostelium discoideum GN=acly PE=1 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.108e-13 Identity = 34/55 (61.82%), Postives = 41/55 (74.55%), Query Frame = 2 Query: 2 AAEVRAPTHIISTISDDRGEEPCYAGAPMSSIVEQGYGVGDVISLLWFKRSLPRY 166 A +VR PT IISTI DDRG+E YAG P+S + ++ Y +GDVI LLWFKR LP Y Sbjct: 358 AGKVRKPTSIISTICDDRGDELSYAGVPISEVCKEQYNMGDVIGLLWFKRKLPPY 412
BLAST of FK826648 vs. ExPASy Swiss-Prot
Match: ACL1_NEUCR (Probable ATP-citrate synthase subunit 1 OS=Neurospora crassa GN=B14D6.310 PE=3 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.497e-11 Identity = 29/52 (55.77%), Postives = 38/52 (73.08%), Query Frame = 2 Query: 11 VRAPTHIISTISDDRGEEPCYAGAPMSSIVEQGYGVGDVISLLWFKRSLPRY 166 +R P ISTISDDRG+E YAG P+S + ++ G+G V+SLLWF+R LP Y Sbjct: 390 IRKPAAFISTISDDRGQELLYAGMPISDVFKEEIGIGGVMSLLWFRRRLPDY 441
BLAST of FK826648 vs. ExPASy Swiss-Prot
Match: ACL1_SORMA (ATP-citrate synthase subunit 1 OS=Sordaria macrospora GN=ACL1 PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.791e-11 Identity = 29/52 (55.77%), Postives = 37/52 (71.15%), Query Frame = 2 Query: 11 VRAPTHIISTISDDRGEEPCYAGAPMSSIVEQGYGVGDVISLLWFKRSLPRY 166 +R P ISTISDDRG+E YAG P+S + + G+G V+SLLWF+R LP Y Sbjct: 394 IRKPAAFISTISDDRGQELLYAGMPISDVFREEIGIGGVMSLLWFRRRLPDY 445 The following BLAST results are available for this feature:
BLAST of FK826648 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FK826648 ID=FK826648; Name=FK826648; organism=Citrus sinensis; type=EST; length=168bpback to top |