FE659165
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of FE659165 vs. ExPASy Swiss-Prot
Match: RTNLB_ARATH (Reticulon-like protein B2 OS=Arabidopsis thaliana GN=RTNLB2 PE=1 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 1.433e-14 Identity = 39/52 (75.00%), Postives = 44/52 (84.62%), Query Frame = -1 Query: 168 LLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSKIPRS-LKDKKK 320 LL TVP+ Y+KYED+VDS+ EKA AE+KKQYAV DAKV SKIPR LKDKKK Sbjct: 219 LLFTVPLFYDKYEDKVDSYGEKAMAELKKQYAVLDAKVFSKIPRGPLKDKKK 270
BLAST of FE659165 vs. ExPASy Swiss-Prot
Match: RTNLD_ARATH (Reticulon-like protein B4 OS=Arabidopsis thaliana GN=RTNLB4 PE=1 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 2.987e-12 Identity = 36/55 (65.45%), Postives = 42/55 (76.36%), Query Frame = -1 Query: 168 LLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVL----SKIPRSLKDKKK 320 LL T+PV+YEKYED+VD++ EKA EIKKQYAV D KVL SKIPR +KKK Sbjct: 202 LLFTIPVLYEKYEDKVDAYGEKAMREIKKQYAVLDEKVLRKVISKIPRGALNKKK 256
BLAST of FE659165 vs. ExPASy Swiss-Prot
Match: RTNLE_ARATH (Reticulon-like protein B5 OS=Arabidopsis thaliana GN=RTNLB5 PE=1 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 8.692e-12 Identity = 34/52 (65.38%), Postives = 42/52 (80.77%), Query Frame = -1 Query: 168 LLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSKIP-RSLKDKKK 320 +LHTVP++YEK+ED+VD +EKA E++KQY VFD KVLSKIP SLK K K Sbjct: 202 ILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKVLSKIPIASLKAKAK 253
BLAST of FE659165 vs. ExPASy Swiss-Prot
Match: RTNLA_ARATH (Reticulon-like protein B1 OS=Arabidopsis thaliana GN=RTNLB1 PE=1 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 1.936e-11 Identity = 35/52 (67.31%), Postives = 40/52 (76.92%), Query Frame = -1 Query: 168 LLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSKIPRS-LKDKKK 320 LL TVP+ Y+KYED+VD EKA E+KKQYAV D KVLSKIP LK+KKK Sbjct: 223 LLFTVPLAYDKYEDKVDPLGEKAMIELKKQYAVLDEKVLSKIPLGPLKNKKK 274
BLAST of FE659165 vs. ExPASy Swiss-Prot
Match: RTNLC_ARATH (Reticulon-like protein B3 OS=Arabidopsis thaliana GN=RTNLB3 PE=1 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.358e-11 Identity = 30/42 (71.43%), Postives = 34/42 (80.95%), Query Frame = -1 Query: 195 LLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSKI 320 LL T+PV+YEKYED+VD F EKA EIKKQY FD KVLSK+ Sbjct: 198 LLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSKV 239 The following BLAST results are available for this feature:
BLAST of FE659165 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 5
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE659165 ID=FE659165; Name=FE659165; organism=Citrus sinensis; type=EST; length=320bpback to top |