EY702695

Overview
NameEY702695
Unique NameEY702695
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length987
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY702695 vs. ExPASy Swiss-Prot
Match: FAD6C_ARATH (Omega-6 fatty acid desaturase, chloroplastic OS=Arabidopsis thaliana GN=FAD6 PE=1 SV=2)

HSP 1 Score: 112.464 bits (280), Expect = 3.977e-24
Identity = 65/118 (55.08%), Postives = 81/118 (68.64%), Query Frame = 1
Query:  121 MACRLADSMFLFMGPHQRPTGSQKIGCFS---SPGLCQLKWESLLVKGVKHK--RCSIP-SRGTRFIQAVAVPVAPPSEDSADCRKQIAESYGFRQIGEPLPENVTMKDVIDSLPKKV 456
            MA R+ADS+F F GP Q      K+   S   SPG+  +K   LL+KG  H+  RC  P  R    I+AVA PVAPPS DSA+ R+Q+AESYGFRQIGE LPENVT+KD++D+LPK+V
Sbjct:    1 MASRIADSLFAFTGPQQCLPRVPKLAASSARVSPGVYAVKPIDLLLKGRTHRSRRCVAPVKRRIGCIKAVAAPVAPPSADSAEDREQLAESYGFRQIGEDLPENVTLKDIMDTLPKEV 118          
BLAST of EY702695 vs. ExPASy Swiss-Prot
Match: FAD6C_SOYBN (Omega-6 fatty acid desaturase, chloroplastic OS=Glycine max PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 8.293e-22
Identity = 53/112 (47.32%), Postives = 72/112 (64.29%), Query Frame = 1
Query:  121 MACRLADSMFLFMGPHQRPTGSQKIGCFSSPGLCQLKWESLLVKGVKHKRCSIPSRGTRFIQAVAVPVAPPSEDSADCRKQIAESYGFRQIGEPLPENVTMKDVIDSLPKKV 456
            MAC LADS+ LF G +Q+P   + I    SPG+  L    L+ K  + +R  +       I AVA+PV P   +SA+ RKQ+AE YGFRQ+GEPL ++VT+KDVI+ LPK+V
Sbjct:    1 MACTLADSLLLFKGSYQKPVLRRDIAARYSPGIFSLNSNGLIQKRFRRQRNFVTRNKVTVIHAVAIPVQPAPVESAEYRKQLAEDYGFRQVGEPLSDDVTLKDVINPLPKEV 112          
BLAST of EY702695 vs. ExPASy Swiss-Prot
Match: FAD6C_BRANA (Omega-6 fatty acid desaturase, chloroplastic OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 5.375e-21
Identity = 54/113 (47.79%), Postives = 76/113 (67.26%), Query Frame = 1
Query:  121 MACRLADSMFLFMGPHQ-RPTGSQKIGCFSSPGLCQLKWESLLVKGVKHKRCSIPSRGTRFIQAVAVPVAPPSEDSADCRKQIAESYGFRQIGEPLPENVTMKDVIDSLPKKV 456
            MA R+ADS+F F GP Q  P   +      SPG+  ++   LL+KG +        +    I+AV VPVAPPS D+A+ R+Q+AESYGF+QIG+ LP+NVT+KD++D+LPK+V
Sbjct:    1 MASRIADSLFAFTGPQQCLPRAPKLASARLSPGVYAVRPIDLLLKGTRRTFLVPAKKRIGCIKAVFVPVAPPSADNAEDREQLAESYGFKQIGQDLPDNVTLKDIMDTLPKEV 113          
BLAST of EY702695 vs. ExPASy Swiss-Prot
Match: FAD6C_SPIOL (Omega-6 fatty acid desaturase, chloroplastic OS=Spinacia oleracea GN=FAD6 PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.515e-15
Identity = 50/113 (44.25%), Postives = 71/113 (62.83%), Query Frame = 1
Query:  205 SSPGLCQLKWESLLVKGVKHKRCSIPSRGTR----FIQAVAVPVAPPSE----DSADCRKQIAESYGFRQIGEPLPENVTMKDVIDSLPKKVLFLFASSCTLNAYVVLLETTS 519
            +S G+  +KW+   ++ + H R +   +GTR     +QAVAVPVA PS     D+ +  KQ+AE YGF+QIGEPLP++VTM+D+I SLPK+V   F  + T     VL+  TS
Sbjct:   27 NSAGISCIKWQRPCLRNLGHVRLNQQRKGTRRKSTLVQAVAVPVAQPSAFPPTDNTEHLKQLAERYGFQQIGEPLPDDVTMRDIITSLPKQV---FEINDTKAWGTVLISVTS 136          
The following BLAST results are available for this feature:
BLAST of EY702695 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
FAD6C_ARATH3.977e-2455.08Omega-6 fatty acid desaturase, chloroplastic OS=Ar... [more]
FAD6C_SOYBN8.293e-2247.32Omega-6 fatty acid desaturase, chloroplastic OS=Gl... [more]
FAD6C_BRANA5.375e-2147.79Omega-6 fatty acid desaturase, chloroplastic OS=Br... [more]
FAD6C_SPIOL1.515e-1544.25Omega-6 fatty acid desaturase, chloroplastic OS=Sp... [more]
back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (2 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-701-011-B10-CT.F Sweet orange fruit, development stadium (2 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY702695 ID=EY702695|Name=EY702695|organism=Citrus sinensis|type=EST|length=987bp
TCACAACGGCCCGGCGGGCCNCCTCCCTCTCCTTTNNGGNGTAANNNAAN
NACANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGCTCGACCCACGC
GTCCGCTTGCTCAATTCACAATGGCTTGCAGACTTGCAGATTCTATGTTC
CTTTTCATGGGCCCCCATCAAAGGCCAACTGGGAGTCAGAAAATTGGATG
CTTTAGTTCACCTGGCCTTTGTCAGCTGAAGTGGGAGAGTCTTCTTGTGA
AGGGAGTTAAGCACAAAAGATGTTCAATTCCCTCTCGAGGGACTAGATTT
ATACAGGCTGTGGCCGTTCCAGTTGCACCACCTTCAGAAGACAGTGCGGA
TTGTAGAAAGCAGATAGCAGAAAGTTATGGGTTTAGGCAAATCGGAGAGC
CACTGCCTGAAAATGTGACAATGAAGGATGTCATTGATTCTCTCCCAAAA
AAGGTGCTTTTTCTTTTTGCGTCTTCTTGCACCCTCAATGCTTATGTTGT
TCTCCTGGAAACTACTTCTCTTATATAATCTATTGTGAATTTGTACCTGC
AATCAAGGGAATTTCTGGCCGAACATTGGTTCATTCAACTTTAGAATATT
TTCTAATTATCCATTATTCTGTTATTGGAGATGTATACTGCAATTAAATT
TTGCGGTAAATTAGCAAGAGCTGTACGGGCACTGGGAATATTTTACTCTT
TCATACCTTTAATTCGTTCTATAAAAAAATCGTGGGGATAGTTTGTAACA
TCCCCTGATGTACCCTTAACGGGAAAAAAAGCTTTCTTTTACTATTGAGG
TGAAGTCAGGTTTCGGAAGTCGAAGCCAAGAAATTAAGAGAACTATGGCC
TCCCTTACCAGGACAACGCCCCCGGGGCCCCATGGGGTATCCGGCCACTT
CTCACAAACCCCTTCTTTTTAATCGTGAAACGAATTTTTTCCCCTTGAAC
TTTGGGGTGCTAGGCATTTGAAAACGCCGAGGGAAAA
back to top