CX078283
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENO_RICCO (Enolase OS=Ricinus communis PE=2 SV=1) HSP 1 Score: 93.9745 bits (232), Expect = 2.597e-19 Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 140 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFR PVEPY Sbjct: 400 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRTPVEPY 445
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENO_ORYSJ (Enolase OS=Oryza sativa subsp. japonica GN=ENO1 PE=1 SV=2) HSP 1 Score: 93.2041 bits (230), Expect = 4.431e-19 Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 140 TGQIKTGAPCRSERLAKYNQLLRIEEELGA AVYAGAKFRAPVEPY Sbjct: 401 TGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY 446
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENO2_MAIZE (Enolase 2 OS=Zea mays GN=ENO2 PE=2 SV=1) HSP 1 Score: 92.4337 bits (228), Expect = 7.557e-19 Identity = 45/46 (97.83%), Postives = 45/46 (97.83%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 140 TGQIKTGAPCRSERLAKYNQLLRIEEELGA AVYAGAKFRAPVEPY Sbjct: 401 TGQIKTGAPCRSERLAKYNQLLRIEEELGAIAVYAGAKFRAPVEPY 446
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENO2_HEVBR (Enolase 2 OS=Hevea brasiliensis GN=ENO2 PE=1 SV=1) HSP 1 Score: 92.0485 bits (227), Expect = 9.870e-19 Identity = 44/46 (95.65%), Postives = 44/46 (95.65%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 140 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGA FR PVEPY Sbjct: 400 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRTPVEPY 445
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENO_ALNGL (Enolase OS=Alnus glutinosa GN=PGH1 PE=2 SV=1) HSP 1 Score: 90.8929 bits (224), Expect = 2.199e-18 Identity = 43/46 (93.48%), Postives = 44/46 (95.65%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 140 TGQIKTGAPCRSERLAKYNQLLRIEEELG+EAVYAGA FR PVEPY Sbjct: 395 TGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRTPVEPY 440
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENO1_MAIZE (Enolase 1 OS=Zea mays GN=ENO1 PE=2 SV=1) HSP 1 Score: 90.8929 bits (224), Expect = 2.199e-18 Identity = 44/46 (95.65%), Postives = 44/46 (95.65%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 140 TGQIKTGAPCRSERLAKYNQLLRIEEELG AVYAGAKFRAPVEPY Sbjct: 401 TGQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGAKFRAPVEPY 446
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENO_SOLLC (Enolase OS=Solanum lycopersicum GN=PGH1 PE=2 SV=1) HSP 1 Score: 90.5077 bits (223), Expect = 2.872e-18 Identity = 43/46 (93.48%), Postives = 44/46 (95.65%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 140 TGQIKTGAPCRSERLAKYNQLLRIEEELG+EAVYAGA FR PVEPY Sbjct: 399 TGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGASFRKPVEPY 444
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENO1_HEVBR (Enolase 1 OS=Hevea brasiliensis GN=ENO1 PE=1 SV=1) HSP 1 Score: 90.5077 bits (223), Expect = 2.872e-18 Identity = 43/46 (93.48%), Postives = 44/46 (95.65%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 140 TGQIKTGAPCRSERLAKYNQLLRIEEELG+EAVYAGA FR PVEPY Sbjct: 400 TGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRKPVEPY 445
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENO_ARATH (Enolase OS=Arabidopsis thaliana GN=ENO PE=1 SV=1) HSP 1 Score: 88.5817 bits (218), Expect = 1.091e-17 Identity = 41/46 (89.13%), Postives = 43/46 (93.48%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 140 TGQIKTGAPCRSERLAKYNQLLRIEEELG+EA+YAG FR PVEPY Sbjct: 399 TGQIKTGAPCRSERLAKYNQLLRIEEELGSEAIYAGVNFRKPVEPY 444
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENO_MESCR (Enolase OS=Mesembryanthemum crystallinum GN=PGH1 PE=2 SV=1) HSP 1 Score: 87.8113 bits (216), Expect = 1.861e-17 Identity = 42/46 (91.30%), Postives = 43/46 (93.48%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 140 TGQIKTGAPCRSERLAKYNQLLRIEEELG +AVYAGA FR PVEPY Sbjct: 399 TGQIKTGAPCRSERLAKYNQLLRIEEELGDKAVYAGANFRRPVEPY 444 The following BLAST results are available for this feature:
BLAST of CX078283 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 69
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX078283 ID=CX078283; Name=CX078283; organism=Citrus sinensis; type=EST; length=382bpback to top |