DR406094

Overview
NameDR406094
Unique NameDR406094
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length637
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DR406094 vs. ExPASy Swiss-Prot
Match: UBC4_SOLLC (Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 1.037e-70
Identity = 125/130 (96.15%), Postives = 128/130 (98.46%), Query Frame = 1
Query:  247 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 636
            MASKRI KELKDLQKDPP SCSAGPVA+DMFHWQATIMGP+DSP+AGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPTDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 130          
BLAST of DR406094 vs. ExPASy Swiss-Prot
Match: UBC9_ARATH (SUMO-conjugating enzyme UBC9 OS=Arabidopsis thaliana GN=UBC9 PE=1 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 2.310e-70
Identity = 124/130 (95.38%), Postives = 128/130 (98.46%), Query Frame = 1
Query:  247 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 636
            MASKRI KELKDLQKDPP SCSAGPVA+DMFHWQATIMGPSDSP++GGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 130          
BLAST of DR406094 vs. ExPASy Swiss-Prot
Match: UBC28_ARATH (Ubiquitin carrier protein E2 28 OS=Arabidopsis thaliana GN=UBC28 PE=2 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 3.017e-70
Identity = 123/130 (94.62%), Postives = 128/130 (98.46%), Query Frame = 1
Query:  247 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 636
            MASKRI KELKDLQKDPP SCSAGPVA+DMFHWQATIMGPSDSP++GGVFLV+IHFPPDYPFKPPKVAFRTKVFHPN+NSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 130          
BLAST of DR406094 vs. ExPASy Swiss-Prot
Match: UBC10_ARATH (Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis thaliana GN=UBC10 PE=1 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 3.017e-70
Identity = 124/130 (95.38%), Postives = 128/130 (98.46%), Query Frame = 1
Query:  247 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 636
            MASKRI KELKDLQKDPP SCSAGPVA+DMFHWQATIMGPS+SP+AGGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 130          
BLAST of DR406094 vs. ExPASy Swiss-Prot
Match: UBC8_ARATH (Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis thaliana GN=UBC8 PE=1 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 1.497e-69
Identity = 122/130 (93.85%), Postives = 128/130 (98.46%), Query Frame = 1
Query:  247 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 636
            MASKRI KELKDLQKDPP SCSAGPVA+DMFHWQATIMGP++SP++GGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 130          
BLAST of DR406094 vs. ExPASy Swiss-Prot
Match: UBC30_ARATH (Ubiquitin carrier protein E2 30 OS=Arabidopsis thaliana GN=UBC30 PE=2 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 9.704e-69
Identity = 119/130 (91.54%), Postives = 126/130 (96.92%), Query Frame = 1
Query:  247 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 636
            MASKRINKEL+DLQ+DPP SCSAGP  DDMF WQATIMGP+DSPFAGGVFLV+IHFPPDYPFKPPKVAFRTKV+HPNINSNGSICLDILKEQWSPALT+SKVLLSICSLLTDPNPDDPLVPEIAH+YKTD
Sbjct:    1 MASKRINKELRDLQRDPPVSCSAGPTGDDMFQWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPPKVAFRTKVYHPNINSNGSICLDILKEQWSPALTVSKVLLSICSLLTDPNPDDPLVPEIAHIYKTD 130          
BLAST of DR406094 vs. ExPASy Swiss-Prot
Match: UBC11_ARATH (Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana GN=UBC11 PE=2 SV=2)

HSP 1 Score: 259.61 bits (662), Expect = 9.704e-69
Identity = 120/130 (92.31%), Postives = 128/130 (98.46%), Query Frame = 1
Query:  247 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 636
            MASKRI KELKDLQKDPP++CSAGPVA+DMFHWQATIMGP +SP+AGGVFLVSIHFPPDYPFKPPKV+F+TKV+HPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD
Sbjct:    1 MASKRILKELKDLQKDPPSNCSAGPVAEDMFHWQATIMGPPESPYAGGVFLVSIHFPPDYPFKPPKVSFKTKVYHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 130          
BLAST of DR406094 vs. ExPASy Swiss-Prot
Match: UBC29_ARATH (Ubiquitin carrier protein E2 29 OS=Arabidopsis thaliana GN=UBC29 PE=2 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 1.713e-65
Identity = 112/130 (86.15%), Postives = 125/130 (96.15%), Query Frame = 1
Query:  247 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 636
            MA++RI KELK+LQ+DPP SCSAGP  +DMFHWQATIMGP++SP++GGVFLV+IHFPPDYPFKPPKV FRTKVFHPNINSNG+ICLDILK+QWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH+YKTD
Sbjct:    1 MATRRILKELKELQRDPPVSCSAGPTGEDMFHWQATIMGPNESPYSGGVFLVNIHFPPDYPFKPPKVVFRTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHIYKTD 130          
BLAST of DR406094 vs. ExPASy Swiss-Prot
Match: UBC4_SCHPO (Ubiquitin-conjugating enzyme E2 4 OS=Schizosaccharomyces pombe GN=ubc4 PE=2 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 7.197e-64
Identity = 110/130 (84.62%), Postives = 122/130 (93.85%), Query Frame = 1
Query:  247 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 636
            MA KRIN+EL DL KDPP+SCSAGPV DD+FHWQATIMGP+DSP+AGGVF +SIHFP DYPFKPPKV F T+++HPNINSNGSICLDIL++QWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH+YKTD
Sbjct:    1 MALKRINRELADLGKDPPSSCSAGPVGDDLFHWQATIMGPADSPYAGGVFFLSIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHVYKTD 130          
BLAST of DR406094 vs. ExPASy Swiss-Prot
Match: UBC1_MAGGR (Ubiquitin-conjugating enzyme E2-16 kDa OS=Magnaporthe grisea GN=UBC1 PE=3 SV=2)

HSP 1 Score: 238.81 bits (608), Expect = 1.773e-62
Identity = 107/129 (82.95%), Postives = 121/129 (93.80%), Query Frame = 1
Query:  247 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKT 633
            MA KRINKEL DL +DPP+SCSAGPV +D+FHWQATIMGPSDSP+AGGVF ++IHFP DYPFKPPKV F T+++HPNINSNGSICLDIL++QWSPALTISKVLLSICS+LTDPNPDDPLVPEIAH+YKT
Sbjct:    1 MALKRINKELTDLGRDPPSSCSAGPVGEDLFHWQATIMGPSDSPYAGGVFFLAIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKT 129          
The following BLAST results are available for this feature:
BLAST of DR406094 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 266
Match NameE-valueIdentityDescription
UBC4_SOLLC1.037e-7096.15Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum ... [more]
UBC9_ARATH2.310e-7095.38SUMO-conjugating enzyme UBC9 OS=Arabidopsis thalia... [more]
UBC28_ARATH3.017e-7094.62Ubiquitin carrier protein E2 28 OS=Arabidopsis tha... [more]
UBC10_ARATH3.017e-7095.38Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis ... [more]
UBC8_ARATH1.497e-6993.85Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis t... [more]
UBC30_ARATH9.704e-6991.54Ubiquitin carrier protein E2 30 OS=Arabidopsis tha... [more]
UBC11_ARATH9.704e-6992.31Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis ... [more]
UBC29_ARATH1.713e-6586.15Ubiquitin carrier protein E2 29 OS=Arabidopsis tha... [more]
UBC4_SCHPO7.197e-6484.62Ubiquitin-conjugating enzyme E2 4 OS=Schizosacchar... [more]
UBC1_MAGGR1.773e-6282.95Ubiquitin-conjugating enzyme E2-16 kDa OS=Magnapor... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248L04 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248L04 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR406094 ID=DR406094|Name=DR406094|organism=Citrus sinensis|type=EST|length=637bp
TTTTTTTTTTTAAATTTCNNAATTATTTCATTAATTTTTAAAATTCCCCA
ATAATCACGCCTTCGTCCCTGATTTTGGTTTGAATTTATAAATAAAGGTT
GTTGCTTCAAATCTGTCGGTACAATTTTTGTACTTTTTAGAATTAGGGTT
AGGGTTTGTGATCGTGTTTTCGATTCTGTTTGCTTTTAAGATATAACCCT
CGAAGTACGGCACTGTTTCTCTGATGGTTTGTTGAGAAATTCCCAGATGG
CTTCAAAACGGATCAACAAGGAGTTGAAGGACCTACAGAAGGACCCTCCT
GCTTCTTGTAGCGCTGGCCCTGTTGCTGATGACATGTTCCATTGGCAAGC
AACAATTATGGGCCCATCAGACAGCCCATTTGCTGGGGGTGTATTTCTTG
TATCCATTCATTTCCCACCTGATTATCCATTCAAGCCACCGAAGGTGGCC
TTCCGTACTAAGGTTTTCCACCCTAACATCAATAGCAATGGTAGCATCTG
TCTTGACATTCTCAAGGAGCAGTGGAGCCCTGCTTTGACAATATCCAAGG
TACTTCTGTCAATTTGCTCACTACTTACTGATCCGAACCCAGATGACCCA
CTTGTGCCTGAGATTGCTCACATGTACAAGACTGACA
back to top