DR406039

Overview
NameDR406039
Unique NameDR406039
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length706
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DR406039 vs. ExPASy Swiss-Prot
Match: ACOT9_MOUSE (Acyl-coenzyme A thioesterase 9, mitochondrial OS=Mus musculus GN=Acot9 PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.365e-24
Identity = 72/215 (33.49%), Postives = 116/215 (53.95%), Query Frame = 2
Query:    5 KKPIRVDIDLELTGAVTWVGRSSMEIQLXXXXXXXXXXXXXXXXALVANFTFVARDTKTGKSAPINQILPETEKEKLLWEEAEQRNKMRKTKRAERKMTAENGDKDRLNALLAEGRIFCDMPALADRDSIL------IKDTCHENSLMCQPQQRNIHGRIFGGFLMRKASELAFSTAYTFAGAAPLFVEVDHVDFLKPVDVGNFLRLKSCVLYTE 631
            K  +  + D++ TG V+WVG +SME+++                 L A F  VARD++    A +N ++PE ++E+ L+++ E  NK R+   +   +       +  N +        D   ++ +  IL      ++DT  ++  +C PQ+RN+  RIFGGFLMRKA ELA++TA +F G+ P  V VD + F KPV+VG+ L L S V +T+
Sbjct:  155 KHSLSPEQDIKFTGHVSWVGNTSMEVKMKMFQLHNDEKYWP---VLDATFVMVARDSENKGPAFVNPLIPENKEEEELFKQGEL-NKSRRIAFSTSSLLKVAPSSEERNIIHELFLTTLDPKTISFQSRILPPKAVWMEDTKLKSLDICHPQERNVFNRIFGGFLMRKAYELAWATACSFGGSRPYVVTVDDIMFQKPVEVGSLLFLSSQVCFTQ 365          
BLAST of DR406039 vs. ExPASy Swiss-Prot
Match: ACOT9_HUMAN (Acyl-coenzyme A thioesterase 9, mitochondrial OS=Homo sapiens GN=ACOT9 PE=1 SV=2)

HSP 1 Score: 111.694 bits (278), Expect = 3.970e-24
Identity = 75/218 (34.40%), Postives = 119/218 (54.59%), Query Frame = 2
Query:    5 KKPIRVDIDLELTGAVTWVGRSSMEIQLXXXXXXXXXXXXXXXXALVANFTFVARDTKTGKSAPINQILPETEKEKLLWEEAEQRNKMRK---TKRAERKMTAENGDKDRLNALLAEGRIFCDMPALADRDSILIKDTCH-ENSLM-----CQPQQRNIHGRIFGGFLMRKASELAFSTAYTFAGAAPLFVEVDHVDFLKPVDVGNFLRLKSCVLYTE 631
            KK +  + D++ +G V+WVG++SME+++                 L A F  VARD++    A +N ++PE+ +E+ L+ + E  NK R+   +  +  KM     ++  ++ +        D   ++ R  +L  +    ENS +     C PQ+RNI  RIFGGFLMRKA ELA++TA +F G+ P  V VD + F KPV+VG+ L L S V +T+
Sbjct:  156 KKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCP----VLDATFVMVARDSENKGPAFVNPLIPESPEEEELFRQGEL-NKGRRIAFSSTSLLKMAPSAEERTTIHEMFLST---LDPKTISFRSRVLPSNAVWMENSKLKSLEICHPQERNIFNRIFGGFLMRKAYELAWATACSFGGSRPFVVAVDDIMFQKPVEVGSLLFLSSQVCFTQ 365          
BLAST of DR406039 vs. ExPASy Swiss-Prot
Match: ACO10_MOUSE (Acyl-coenzyme A thioesterase 10, mitochondrial OS=Mus musculus GN=Acot10 PE=2 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 6.773e-24
Identity = 70/215 (32.56%), Postives = 116/215 (53.95%), Query Frame = 2
Query:    5 KKPIRVDIDLELTGAVTWVGRSSMEIQLXXXXXXXXXXXXXXXXALVANFTFVARDTKTGKSAPINQILPETEKEKLLWEEAEQRNKMRKTKRAERKMTAENGDKDRLNALLAEGRIFCDMPALADRDSIL------IKDTCHENSLMCQPQQRNIHGRIFGGFLMRKASELAFSTAYTFAGAAPLFVEVDHVDFLKPVDVGNFLRLKSCVLYTE 631
            K  +  + D++ TG V+WVG ++ME+++                 L A F  VA+D++  + A +N ++PE ++E+ L+ + E  NK R+   +   +       +  N +        D   ++ +  IL      ++DT  ++  +C PQ+RN+  RIFGGFLMRKA ELA++TA +F G+ P  V VD + F KPV+VG+ L L S V +T+
Sbjct:  155 KHSLSPEQDIKFTGHVSWVGNTTMEVKMKMFQLHDDETYWP---VLDATFVMVAQDSENKRPAFVNPLIPENKEEEELFTQGEL-NKSRRIAFSTSSLLKVAPSSEERNIIHELFLSTLDPKTISFQSRILPPKAVWMEDTKLKSLDICHPQERNVFNRIFGGFLMRKAYELAWATACSFGGSRPYVVTVDDIMFQKPVEVGSLLFLSSQVCFTQ 365          
BLAST of DR406039 vs. ExPASy Swiss-Prot
Match: ACOT9_BOVIN (Acyl-coenzyme A thioesterase 9, mitochondrial OS=Bos taurus GN=ACOT9 PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.845e-22
Identity = 70/216 (32.41%), Postives = 116/216 (53.70%), Query Frame = 2
Query:    5 KKPIRVDIDLELTGAVTWVGRSSMEIQLXXXXXXXXXXXXXXXXALVANFTFVARDTKTGKSAPINQILPETEKEKLLWEEAE----QRNKMRKTKRAERKMTAENGDKDR---LNALLAEGRIFCDMPALADRDSILIKDTCHENSLMCQPQQRNIHGRIFGGFLMRKASELAFSTAYTFAGAAPLFVEVDHVDFLKPVDVGNFLRLKSCVLYTE 631
            KK +  + D++ +G V+WVG++SME+++                 L A F  VARD++    A +N ++ E+ +E+ L+++ E    +R     T   +   TAE         LN L  + +       +   +S+ ++++  ++  +C PQ+RNI  RIFGGFLMRKA EL ++TA  F G+ P  V VD + F KPV+VG+ L L + V +T+
Sbjct:  154 KKNLSPEQDIKFSGHVSWVGKTSMEVKMHMFQLHGNDFSP----VLDATFVMVARDSENKGPAFVNPLILESPEEEELFQQGELNKGRRVAFSSTSLLKMAPTAEERTTIHEMFLNTL--DPKTISFRSRVLPANSVWMENSKLKSLDICHPQERNIFNRIFGGFLMRKAYELGWATACNFGGSRPFIVAVDDIMFQKPVEVGSLLFLSAQVCFTQ 363          
The following BLAST results are available for this feature:
BLAST of DR406039 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
ACOT9_MOUSE1.365e-2433.49Acyl-coenzyme A thioesterase 9, mitochondrial OS=M... [more]
ACOT9_HUMAN3.970e-2434.40Acyl-coenzyme A thioesterase 9, mitochondrial OS=H... [more]
ACO10_MOUSE6.773e-2432.56Acyl-coenzyme A thioesterase 10, mitochondrial OS=... [more]
ACOT9_BOVIN2.845e-2232.41Acyl-coenzyme A thioesterase 9, mitochondrial OS=B... [more]
back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248I14 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248I14 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR406039 ID=DR406039|Name=DR406039|organism=Citrus sinensis|type=EST|length=706bp
GGGGAAGAAACCAATCCGTGTTGACATCGATTTGGAATTAACTGGAGCTG
TTACATGGGTTGGGCGGTCTTCCATGGAGATTCAACTTGAAGTGACTCAA
TCCACACAAGATACTACAGATTCAACGGAATCAGTAGCCCTTGTGGCAAA
CTTCACATTTGTAGCTCGTGACACCAAGACAGGAAAATCAGCTCCAATTA
ACCAGATCTTGCCTGAAACGGAGAAAGAAAAATTGCTTTGGGAAGAAGCT
GAGCAAAGGAACAAAATGCGGAAAACAAAGAGAGCAGAAAGGAAAATGAC
TGCTGAAAATGGAGATAAAGACAGGCTTAATGCATTGTTGGCTGAAGGGC
GAATCTTCTGTGACATGCCAGCACTGGCAGACAGAGATAGCATTCTTATT
AAGGATACATGCCATGAGAACTCCTTGATGTGTCAGCCACAGCAAAGGAA
CATTCATGGTCGGATTTTTGGCGGATTTTTGATGCGTAAAGCATCTGAAC
TGGCCTTCTCAACTGCTTACACATTTGCTGGTGCAGCACCTCTCTTTGTT
GAAGTAGATCATGTTGATTTTTTAAAACCTGTGGATGTCGGAAACTTCCT
CCGTCTCAAGTCATGTGTTTTGTATACGGAACTTGAGAACCCAGCCAGAC
CTCTGATAAATGTAGAAGTTGTAGCTCATGTTACAAGTCCTGANNTAAGG
GCCAGT
back to top