DR406035

Overview
NameDR406035
Unique NameDR406035
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length708
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13132 contig Csv1_Contig13132:223..930. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR406035 vs. ExPASy Swiss-Prot
Match: FACE1_ARATH (CAAX prenyl protease 1 homolog OS=Arabidopsis thaliana GN=FACE1 PE=1 SV=1)

HSP 1 Score: 441.81 bits (1135), Expect = 1.675e-123
Identity = 217/235 (92.34%), Postives = 225/235 (95.74%), Query Frame = 3
Query:    3 GPYLAIYLWAFMFVLSLVMMTLYPVLIAPLFNKFTPLPEGELREKIEKLASSLKFPLKKLFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQCKNGEEIVAVIAHELGHWKLNHTMYSFIAVQVLTLLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVIPIQHLVSFGLNLVSRSFEFQADAFAKKLGYASALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVER 707
            GPYLAIYLWAFMF+LSLVMMT+YPVLIAPLFNKFTPLP+G+LREKIEKLASSLKFPLKKLFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQCKN +EIVAVIAHELGHWKLNHT YSFIAVQ+L  LQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVIP+QHLVSFGLNLVSR+FEFQADAFA KLGYA  LR  LVKLQEENLSAMNTDP YSAYHYSHPPLVER
Sbjct:  178 GPYLAIYLWAFMFILSLVMMTIYPVLIAPLFNKFTPLPDGDLREKIEKLASSLKFPLKKLFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQCKNEDEIVAVIAHELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVER 412          
BLAST of DR406035 vs. ExPASy Swiss-Prot
Match: FACE1_ORYSJ (CAAX prenyl protease 1 homolog OS=Oryza sativa subsp. japonica GN=FACE1 PE=2 SV=1)

HSP 1 Score: 422.55 bits (1085), Expect = 1.052e-117
Identity = 203/235 (86.38%), Postives = 219/235 (93.19%), Query Frame = 3
Query:    3 GPYLAIYLWAFMFVLSLVMMTLYPVLIAPLFNKFTPLPEGELREKIEKLASSLKFPLKKLFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQCKNGEEIVAVIAHELGHWKLNHTMYSFIAVQVLTLLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVIPIQHLVSFGLNLVSRSFEFQADAFAKKLGYASALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVER 707
            GPYLAIYLW FMF LSLVMMT+YP++IAPLFNKFTPLPEG LREKIEKLA+SL FPLKKLFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQC + +EIV+VIAHELGHWKLNHT+YSF+AVQ+L  LQFGGYTLVRNS DLF SFGF+ QPV+IGLIIFQHT+IP+QHL+SF LNLVSR+FEFQADAFAK LGYA  LRA LVKLQEENLSAMNTDPWYSAYHYSHPPLVER
Sbjct:  178 GPYLAIYLWGFMFALSLVMMTIYPIVIAPLFNKFTPLPEGVLREKIEKLAASLSFPLKKLFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQCSSEDEIVSVIAHELGHWKLNHTVYSFVAVQLLMFLQFGGYTLVRNSKDLFESFGFEDQPVIIGLIIFQHTIIPVQHLLSFCLNLVSRAFEFQADAFAKNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHYSHPPLVER 412          
BLAST of DR406035 vs. ExPASy Swiss-Prot
Match: FACE1_HUMAN (CAAX prenyl protease 1 homolog OS=Homo sapiens GN=ZMPSTE24 PE=1 SV=2)

HSP 1 Score: 246.899 bits (629), Expect = 7.908e-65
Identity = 135/274 (49.27%), Postives = 177/274 (64.60%), Query Frame = 3
Query:    3 GPYLAIYLWAFMFVLSLVMMTLYPVLIAPLFNKFTPLPEGELREKIEKLASSLKFPLKKLFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQ-------------------------------------CKNGEEIVAVIAHELGHWKLNHTMYSFIAVQVLTLLQFGGYTLVRNSTDLFRSFGF-DTQPVLIG-LIIFQHTVIPIQHLVSFGLNLVSRSFEFQADAFAKKLGYASALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVER 707
            G Y  IY W F  V+SLV++T+Y   IAPLF+KFTPLPEG+L+E+IE +A S+ FPL K++VV+GS RSSHSNAY YGFFKNKRIVL+DTL+++                                     CKN EE++AV+ HELGHWKL HT+ + I  Q+ + L F  + ++    +LF +FGF D+QP LIG LIIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +HYSHPPL+ER
Sbjct:  193 GDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKEEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVLNKDIQEDSGMEPRNEEEGNSEEIKAKVKNKKQGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMWHYSHPPLLER 465          
BLAST of DR406035 vs. ExPASy Swiss-Prot
Match: FACE1_MOUSE (CAAX prenyl protease 1 homolog OS=Mus musculus GN=Zmpste24 PE=1 SV=2)

HSP 1 Score: 246.128 bits (627), Expect = 1.349e-64
Identity = 134/274 (48.91%), Postives = 177/274 (64.60%), Query Frame = 3
Query:    3 GPYLAIYLWAFMFVLSLVMMTLYPVLIAPLFNKFTPLPEGELREKIEKLASSLKFPLKKLFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQ-------------------------------------CKNGEEIVAVIAHELGHWKLNHTMYSFIAVQVLTLLQFGGYTLVRNSTDLFRSFGF-DTQPVLIG-LIIFQHTVIPIQHLVSFGLNLVSRSFEFQADAFAKKLGYASALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVER 707
            G Y  IY W F  V+SLV++T+Y   IAPLF+KFTPLPEG+L+++IE +A S+ FPL K++VV+GS RSSHSNAY YGFFKNKRIVL+DTL+++                                     CKN EE++AV+ HELGHWKL HT+ + I  Q+ + L F  + ++    +LF +FGF D+QP LIG LIIFQ    P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +HYSHPPL+ER
Sbjct:  193 GDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKQEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVPNKDNQEESGMEARNEGEGDSEEVKAKVKNKKQGCKN-EEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRRELFAAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSTWHYSHPPLLER 465          
BLAST of DR406035 vs. ExPASy Swiss-Prot
Match: STE24_YEAST (CAAX prenyl protease 1 OS=Saccharomyces cerevisiae GN=STE24 PE=1 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 2.911e-59
Identity = 115/245 (46.94%), Postives = 161/245 (65.71%), Query Frame = 3
Query:   21 YLWAFMFVLSLVMMTLYPVLIAPLFNKFTPLPEGELREKIEKLASSLKFPLKKLFVVDGSTRSSHSNAYMYGF-FKNKRIVLYDTLIQQCKNGEEIVAVIAHELGHWKLNHTMYSFIAVQVLTLLQFGGYTLVRNSTDLFRSFGFDTQ---------------PVLIGLIIFQHTVIPIQHLVSFGLNLVSRSFEFQADAFAKKLGYASALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVER 707
            Y+  F+FV+ ++ MT+ PV I P+FNKFTPL +GEL++ IE LA  + FPL K+FV+DGS RSSHSNAY  G  F +KRIVL+DTL+    + +EI AV+AHE+GHW+ NH +   I  Q+ T L F  +T +  +T  + +FGF  +               P++IG ++F   + P++  + F ++L+SR+ E+QADA+AKKLGY   L   L+ LQ +NLS MN DP YS+YHYSHP L ER
Sbjct:  197 YIMVFLFVVQILAMTIIPVFIMPMFNKFTPLEDGELKKSIESLADRVGFPLDKIFVIDGSKRSSHSNAYFTGLPFTSKRIVLFDTLVNS-NSTDEITAVLAHEIGHWQKNHIVNMVIFSQLHTFLIFSLFTSIYRNTSFYNTFGFFLEKSTGSFVDPVITKEFPIIIGFMLFNDLLTPLECAMQFVMSLISRTHEYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAER 440          
BLAST of DR406035 vs. ExPASy Swiss-Prot
Match: STE24_SCHPO (Probable CAAX prenyl protease 1 OS=Schizosaccharomyces pombe GN=SPAC3H1.05 PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 4.809e-54
Identity = 104/236 (44.07%), Postives = 155/236 (65.68%), Query Frame = 3
Query:    3 GPYLAIYLWAFMFVLSLVMMTLYPVLIAPLFNKFTPLPEGELREKIEKLASSLKFPLKKLFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQCKNGEEIVAVIAHELGHWKLNHTMYSFIAVQVLTLLQFGGYTLVRNSTDLFRSFGFDTQ-PVLIGLIIFQHTVIPIQHLVSFGLNLVSRSFEFQADAFAKKLGYASALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVER 707
            G    +Y W    V  L++ T+ P LI PLF KFTPL  G LR +IE+LA+S+ FPLKKL+V+D S RS+HSNA+ YG   NK IVL+DTL++      E++A++ HELGHW ++H + + I    ++L     +     +  L+ SF F T+ PV++GL++F   + P+  +++F  N VSR  E+QADAFAK+LGYA  L  GL+++ ++NLS +  D  Y++Y++SHP LV+R
Sbjct:  227 GDNFIMYAWGAYIVFGLILQTIAPSLIMPLFYKFTPLENGSLRTQIEELAASINFPLKKLYVIDASRRSTHSNAFFYGLPWNKGIVLFDTLVKN-HTEPELIAILGHELGHWYMSHNLINTIIDYGMSLFHLFLFAAFIRNNSLYTSFNFITEKPVIVGLLLFSDALGPLSSILTFASNKVSRLCEYQADAFAKQLGYAKDLGDGLIRIHDDNLSPLEFDSLYTSYYHSHPILVDR 461          
BLAST of DR406035 vs. ExPASy Swiss-Prot
Match: FACE1_DICDI (CAAX prenyl protease 1 homolog OS=Dictyostelium discoideum GN=zmpste24 PE=3 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 4.976e-51
Identity = 108/239 (45.19%), Postives = 148/239 (61.92%), Query Frame = 3
Query:    3 GPYLAIYLWAFMFVLSLVMMTLYPVLIAPLFNKFTPLPEGELREKIEKLASSLKFPLKK--LFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQCKNGEEIVAVIAHELGHWKLNHTMYSFIAVQVLTLLQFGGYTLVRNSTDLFRSFGF--DTQPVLIGLIIFQHTVIPIQHLVSFGLNLVSRSFEFQADAFAKKLGYASALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVER 707
            GP L  Y W  +  ++L+ +T+YP  I PLFNKFTP+ +GEL E I  LA  + FP  K  +FVVD S R  H NAY YG F  KRIVLYDTL+ +  + EE++AV+ HE GH+K++HT+   + VQV  +     ++L+ N   L++ FGF      VL+GL +F     PI  + S  +N+ SR +EFQAD FA +LG+ ++    L KL  + L  +  DP YSAYH+SHP LVER
Sbjct:  176 GPQLWFYCWLLLVAITLLSITIYPTFIQPLFNKFTPV-DGELAESIFALAKRVGFPASKDTIFVVDNSKRDGHMNAYFYGLFGTKRIVLYDTLVNEL-DKEELLAVMGHEFGHYKMSHTLKQMLLVQVHLVTLLYAFSLLINDDQLYQQFGFVSSKDSVLVGLTLFMFLYSPIDRIFSLLINIFSRKYEFQADDFAVELGFLNSNH--LFKLHFKELGCLVYDPLYSAYHHSHPTLVER 410          
BLAST of DR406035 vs. ExPASy Swiss-Prot
Match: YHFN_BACSU (Uncharacterized metalloprotease yhfN OS=Bacillus subtilis GN=yhfN PE=3 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 9.472e-18
Identity = 71/239 (29.71%), Postives = 114/239 (47.70%), Query Frame = 3
Query:   18 IYLWAFMFVLSLVMMTLYPVLIAPLFNKFTPLPEGELREKIEKLASSLKFPLKKLFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQCKNGEEIVAVIAHELGHWKLNHTMYSFIAVQVLTLLQFGGY----TLVRNSTDLFRS-FGFDTQPVLIGLIIFQHTVIPIQHLVSFGLNLVSRSFEFQADAFAKKLGYASALRAGLVK----LQEENLSAMNTDPWYSAYHYSHPPLVER 707
            +Y W      SL +  + PV+I PL+N F PL   EL  KI +LA     P   ++ V+ S +++  NAY+ G   NKRIVL+DT + +  +  EI+ ++ HE+GH+ + H    +I +    L+   G+     L + +  L RS F  + +  L  L +       +   V+   N VSR  E +AD +  +L   +  R   VK    L    LS ++       +  SHP ++ER
Sbjct:  177 LYAWLLTVPFSLFLFFIQPVIIDPLYNDFYPLKNKELESKILELADEANIPADHVYEVNMSEKTNALNAYVTGIGANKRIVLWDTTLNKL-DDSEILFIMGHEMGHYVMKHV---YIGLAGYLLVSLAGFYVIDKLYKRTVRLTRSMFHLEGRHDLAALPLLLLLFSVLSFAVTPFSNAVSRYQENKADQYGIEL---TENREAAVKTFQDLAVTGLSQVDPPVLVKIFRGSHPSIMER 408          
The following BLAST results are available for this feature:
BLAST of DR406035 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
FACE1_ARATH1.675e-12392.34CAAX prenyl protease 1 homolog OS=Arabidopsis thal... [more]
FACE1_ORYSJ1.052e-11786.38CAAX prenyl protease 1 homolog OS=Oryza sativa sub... [more]
FACE1_HUMAN7.908e-6549.27CAAX prenyl protease 1 homolog OS=Homo sapiens GN=... [more]
FACE1_MOUSE1.349e-6448.91CAAX prenyl protease 1 homolog OS=Mus musculus GN=... [more]
STE24_YEAST2.911e-5946.94CAAX prenyl protease 1 OS=Saccharomyces cerevisiae... [more]
STE24_SCHPO4.809e-5444.07Probable CAAX prenyl protease 1 OS=Schizosaccharom... [more]
FACE1_DICDI4.976e-5145.19CAAX prenyl protease 1 homolog OS=Dictyostelium di... [more]
YHFN_BACSU9.472e-1829.71Uncharacterized metalloprotease yhfN OS=Bacillus s... [more]
back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248I10 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248I10 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR406035 ID=DR406035|Name=DR406035|organism=Citrus sinensis|type=EST|length=708bp
GGGGTCCTTATCTGGCCATCTATCTTTGGGCATTTATGTTTGTTCTTTCT
CTTGTGATGATGACACTATACCCCGTTTTAATTGCCCCTCTGTTCAATAA
GTTTACTCCTCTTCCAGAAGGAGAGCTAAGGGAGAAAATTGAGAAACTTG
CTTCCTCCCTCAAGTTTCCTTTAAAGAAGTTGTTCGTAGTTGATGGATCC
ACAAGGTCAAGCCACAGCAATGCCTATATGTATGGATTCTTTAAGAATAA
GCGAATTGTCCTTTATGACACTTTGATACAACAGTGCAAAAATGGCGAGG
AAATTGTAGCTGTTATAGCTCATGAGCTTGGGCACTGGAAACTTAACCAT
ACAATGTACTCATTCATTGCTGTTCAGGTTCTTACACTCTTACAATTTGG
AGGATATACCCTTGTGAGGAACTCAACAGATCTCTTCCGAAGCTTTGGGT
TCGACACACAGCCAGTTCTCATTGGTCTAATCATCTTTCAGCATACTGTA
ATACCAATCCAACACTTAGTAAGCTTTGGTCTTAATCTTGTGAGCCGATC
TTTTGAATTTCAGGCTGATGCTTTTGCTAAGAAGCTTGGTTATGCCTCTG
CTCTTCGTGCTGGTCTTGTGAAACTACAGGAAGAAAATTTGTCGGCTATG
AATACGGATCCTTGGTACTCAGCTTATCACTATTCTCATCCCCCACTTGT
CGAGCGAC
back to top