DR406034

Overview
NameDR406034
Unique NameDR406034
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length678
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DR406034_ssr635 microsatellite DR406034_ssr635:635..646. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig13714 contig Csv1_Contig13714:428..1105. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR406034 vs. ExPASy Swiss-Prot
Match: HS17C_ARATH (17.6 kDa class I heat shock protein 3 OS=Arabidopsis thaliana GN=HSP17.6C PE=2 SV=2)

HSP 1 Score: 198.364 bits (503), Expect = 2.961e-50
Identity = 100/158 (63.29%), Postives = 115/158 (72.78%), Query Frame = 3
Query:   75 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFXXXXXXXXXXXXRETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLAVTXXXXXXXXXXXXAIEISG 548
            MSLIPSIFGGRRTNVFDP SLDV+DPF+GF             + + F NA++DW+ETP+AHVFKADLPGLR          G ILQISGERS E EEKNDKWHRVERSSGKF RRFRLP+NAK+E++KASMENGVL+VT            +I+ISG
Sbjct:    1 MSLIPSIFGGRRTNVFDPFSLDVFDPFEGFLTPSGLANAPAM-DVAAFTNAKVDWRETPEAHVFKADLPGLRKEEVKVEVEDGNILQISGERSNENEEKNDKWHRVERSSGKFTRRFRLPENAKMEEIKASMENGVLSVTVPKVPEKKPEVKSIDISG 157          
BLAST of DR406034 vs. ExPASy Swiss-Prot
Match: HSP11_DAUCA (17.8 kDa class I heat shock protein OS=Daucus carota PE=3 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 3.867e-50
Identity = 99/158 (62.66%), Postives = 114/158 (72.15%), Query Frame = 3
Query:   75 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFXXXXXXXXXXXXRETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLAVTXXXXXXXXXXXXAIEISG 548
            MS+IPS FGGRR+NVFDP SLDVWDPF  F            +ET+ F N  IDWKETPQAHVFKADLPGL+          G++LQISGER+KE+EEKNDKWHRVERSSGKFLRRFRLP+NAKV++VKA+M NGV+ VT            AI+ISG
Sbjct:    1 MSIIPSFFGGRRSNVFDPFSLDVWDPFKDFPLVTSSASEFG-KETAAFVNTHIDWKETPQAHVFKADLPGLKKEEVKVELEEGKVLQISGERNKEKEEKNDKWHRVERSSGKFLRRFRLPENAKVDEVKAAMANGVVTVTVPKVEIKKPEVKAIDISG 157          
BLAST of DR406034 vs. ExPASy Swiss-Prot
Match: HSP17_ARATH (17.4 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP17.4A PE=1 SV=2)

HSP 1 Score: 197.208 bits (500), Expect = 6.597e-50
Identity = 96/158 (60.76%), Postives = 115/158 (72.78%), Query Frame = 3
Query:   75 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFXXXXXXXXXXXXRETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLAVTXXXXXXXXXXXXAIEISG 548
            MSL+PS FGGRRTNVFDP SLDVWDPF+GF            ++ + F NA++DW+ETP+AHVFKAD+PGL+          G ILQISGERS E EEK+D WHRVERSSGKF+RRFRLP+NAKVE+VKASMENGVL+VT            +++ISG
Sbjct:    1 MSLVPSFFGGRRTNVFDPFSLDVWDPFEGFLTPGLTNAPA--KDVAAFTNAKVDWRETPEAHVFKADVPGLKKEEVKVEVEDGNILQISGERSSENEEKSDTWHRVERSSGKFMRRFRLPENAKVEEVKASMENGVLSVTVPKVQESKPEVKSVDISG 156          
BLAST of DR406034 vs. ExPASy Swiss-Prot
Match: HS181_ARATH (18.1 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 1.919e-49
Identity = 97/159 (61.01%), Postives = 114/159 (71.70%), Query Frame = 3
Query:   75 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFXXXXXXXXXXXX-RETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLAVTXXXXXXXXXXXXAIEISG 548
            MSLIPSIFGGRR+NVFDP S D+WDPF+GF             R+ + F NAR+DWKETP+AHVFKADLPGL+            +LQISGERSKE EEKNDKWHRVER+SGKF+RRFRLP+NAK+E+VKA+MENGVL V             +I+ISG
Sbjct:    1 MSLIPSIFGGRRSNVFDPFSQDLWDPFEGFFTPSSALANASTARDVAAFTNARVDWKETPEAHVFKADLPGLKKEEVKVEVEDKNVLQISGERSKENEEKNDKWHRVERASGKFMRRFRLPENAKMEEVKATMENGVLTVVVPKAPEKKPQVKSIDISG 159          
BLAST of DR406034 vs. ExPASy Swiss-Prot
Match: HSP12_MEDSA (18.2 kDa class I heat shock protein OS=Medicago sativa GN=HSP18.2 PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 2.507e-49
Identity = 95/158 (60.13%), Postives = 112/158 (70.89%), Query Frame = 3
Query:   75 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFXXXXXXXXXXXXRETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLAVTXXXXXXXXXXXXAIEISG 548
            MSLIPS FGGRR+NVFDP SLDVWDPF  F            RE S F + R+DWKETP+AHVFKADLPG++           R+LQISGERS E+E+KND+WHR+ERSSGKF+RRFRLP+NAK++QVKA+MENGVL VT             I+ISG
Sbjct:    1 MSLIPSFFGGRRSNVFDPFSLDVWDPFKDFPFNNSALSASFPRENSAFVSTRVDWKETPEAHVFKADLPGMKKEEVKVEIEDDRVLQISGERSVEKEDKNDQWHRLERSSGKFMRRFRLPENAKMDQVKAAMENGVLTVTVPKEEVKKPEVKTIDISG 158          
BLAST of DR406034 vs. ExPASy Swiss-Prot
Match: HSP13_SOYBN (17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-M PE=3 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 5.584e-49
Identity = 99/158 (62.66%), Postives = 111/158 (70.25%), Query Frame = 3
Query:   75 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFXXXXXXXXXXXXRETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLAVTXXXXXXXXXXXXAIEISG 548
            MSLIPSIFGGRR+NVFDP SLDVWDPF  F             E S F N R+DWKETP+AHVF+AD+PGL+           R+LQISGER+ E+E+KND WHRVERSSG F+RRFRLP+NAKVEQVKASMENGVL VT            AIEISG
Sbjct:    1 MSLIPSIFGGRRSNVFDPFSLDVWDPFKDFHFPTSLSA-----ENSAFVNTRVDWKETPEAHVFEADIPGLKKEEVKVQIEDDRVLQISGERNLEKEDKNDTWHRVERSSGNFMRRFRLPENAKVEQVKASMENGVLTVTVPKEEVKKPDVKAIEISG 153          
BLAST of DR406034 vs. ExPASy Swiss-Prot
Match: HSP16_SOYBN (18.5 kDa class I heat shock protein OS=Glycine max GN=HSP18.5-C PE=3 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 1.625e-48
Identity = 98/161 (60.87%), Postives = 111/161 (68.94%), Query Frame = 3
Query:   75 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFXXXXXXXXXXXX---RETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLAVTXXXXXXXXXXXXAIEISG 548
            MSLIP+ FGGRR NVFDP SLDVWDPF  F               RE S F + R+DWKETP+AHVFKAD+PGL+           ++LQISGER+ E+E+KND WHRVERSSGKF+RRFRLP+NAKVEQVKASMENGVL VT            AIEISG
Sbjct:    1 MSLIPNFFGGRRNNVFDPFSLDVWDPFKDFPFPNTLSSASFPEFSRENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKVQIEDDKVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKVEQVKASMENGVLTVTVPKEEVKKPDVKAIEISG 161          
BLAST of DR406034 vs. ExPASy Swiss-Prot
Match: HSP11_PEA (18.1 kDa class I heat shock protein OS=Pisum sativum GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 1.625e-48
Identity = 96/158 (60.76%), Postives = 110/158 (69.62%), Query Frame = 3
Query:   75 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFXXXXXXXXXXXXRETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLAVTXXXXXXXXXXXXAIEISG 548
            MSLIPS F GRR+NVFDP SLDVWDP   F            RE   F + R+DWKETP+AHVFKADLPGL+           R+LQISGERS E+E+KND+WHRVERSSGKFLRRFRLP+NAK+++VKASMENGVL VT            +IEISG
Sbjct:    1 MSLIPSFFSGRRSNVFDPFSLDVWDPLKDFPFSNSSPSASFPRENPAFVSTRVDWKETPEAHVFKADLPGLKKEEVKVEVEDDRVLQISGERSVEKEDKNDEWHRVERSSGKFLRRFRLPENAKMDKVKASMENGVLTVTVPKEEIKKAEVKSIEISG 158          
BLAST of DR406034 vs. ExPASy Swiss-Prot
Match: HSP11_SOYBN (17.3 kDa class I heat shock protein OS=Glycine max GN=HSP17.3-B PE=3 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.053e-47
Identity = 96/158 (60.76%), Postives = 111/158 (70.25%), Query Frame = 3
Query:   75 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFXXXXXXXXXXXXRETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLAVTXXXXXXXXXXXXAIEISG 548
            MSLIPS FGGRR++VFDP SLDVWDPF  F             E S F + R+DWKETP+AHVFKAD+PGL+          GR+LQISGER+ E+E+KND WHRVERSSGK +RRFRLP+NAKV+QVKASMENGVL VT            AI+ISG
Sbjct:    1 MSLIPSFFGGRRSSVFDPFSLDVWDPFKDFPFPSSLSA-----ENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKLEIQDGRVLQISGERNVEKEDKNDTWHRVERSSGKLVRRFRLPENAKVDQVKASMENGVLTVTVPKEEIKKPDVKAIDISG 153          
BLAST of DR406034 vs. ExPASy Swiss-Prot
Match: HSP14_SOYBN (17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-E PE=3 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 6.826e-47
Identity = 95/158 (60.13%), Postives = 108/158 (68.35%), Query Frame = 3
Query:   75 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFXXXXXXXXXXXXRETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLAVTXXXXXXXXXXXXAIEISG 548
            MSLIP  FGGRR+NVFDP SLD+WDPF  F             E S F + R+DWKETP+AHVFKAD+PGL+           R+LQISGER+ E+E+KND WHRVERSSGKF RRFRLP+NAKV +VKASMENGVL VT            AIEISG
Sbjct:    1 MSLIPGFFGGRRSNVFDPFSLDMWDPFKDFHVPTSSVSA----ENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKVQIEDDRVLQISGERNVEKEDKNDTWHRVERSSGKFTRRFRLPENAKVNEVKASMENGVLTVTVPKEEVKKPDVKAIEISG 154          
The following BLAST results are available for this feature:
BLAST of DR406034 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
HS17C_ARATH2.961e-5063.2917.6 kDa class I heat shock protein 3 OS=Arabidops... [more]
HSP11_DAUCA3.867e-5062.6617.8 kDa class I heat shock protein OS=Daucus caro... [more]
HSP17_ARATH6.597e-5060.7617.4 kDa class I heat shock protein OS=Arabidopsis... [more]
HS181_ARATH1.919e-4961.0118.1 kDa class I heat shock protein OS=Arabidopsis... [more]
HSP12_MEDSA2.507e-4960.1318.2 kDa class I heat shock protein OS=Medicago sa... [more]
HSP13_SOYBN5.584e-4962.6617.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP16_SOYBN1.625e-4860.8718.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP11_PEA1.625e-4860.7618.1 kDa class I heat shock protein OS=Pisum sativ... [more]
HSP11_SOYBN1.053e-4760.7617.3 kDa class I heat shock protein OS=Glycine max... [more]
HSP14_SOYBN6.826e-4760.1317.5 kDa class I heat shock protein OS=Glycine max... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248I09 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248I09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR406034 ID=DR406034|Name=DR406034|organism=Citrus sinensis|type=EST|length=678bp
GGGGATCTTCAAATTGATTGATCAAAGCATTTCCGAAGTTGTTGAGCATT
TAATTAGCGTCCCAGTTTGCCATAATGTCACTCATTCCAAGCATCTTCGG
TGGCCGAAGAACCAACGTGTTCGATCCAGTTTCATTAGATGTATGGGATC
CTTTCGACGGGTTCTTGTCCTCTGCCCTTACCAACGCGCTGTCTTCGGCT
AGGGAAACATCCCAATTCGCCAATGCAAGAATTGACTGGAAAGAGACTCC
TCAGGCTCATGTATTCAAAGCTGATCTTCCAGGGCTGAGGAAAGAAGAAG
TAAAAGTTGAGGTTGAAGAGGGCAGGATTCTGCAGATAAGCGGAGAGAGG
AGCAAGGAGCAGGAAGAGAAGAATGACAAGTGGCATCGCGTCGAGAGGAG
CAGTGGCAAGTTCCTGAGGAGGTTCAGGTTGCCCGACAATGCTAAGGTGG
AACAGGTTAAGGCCAGCATGGAGAATGGTGTGCTCGCAGTCACCGTTCCT
AAACAGGAGGAGAAGAAACCTGAAGTTAAGGCTATTGAGATCTCTGGCTA
AGTGATAACTGTAAATGTTTTCAAGATAGTGTCTTTGGTTTGCTAATAAA
TTTGGTACGAAAGCAAAGCCCTTGTGTGTTCGTATGTGTGTGTGTGTTTG
TTTTCTTCCCTTCCCCCTGTTTAATTTG
back to top