DR405941

Overview
NameDR405941
Unique NameDR405941
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length768
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6305 contig Csv1_Contig6305:1..768. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR405941 vs. ExPASy Swiss-Prot
Match: BCKD_RAT ([3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Rattus norvegicus GN=Bckdk PE=1 SV=2)

HSP 1 Score: 125.946 bits (315), Expect = 2.358e-28
Identity = 72/234 (30.77%), Postives = 126/234 (53.85%), Query Frame = 1
Query:   55 AKKLSETFSKTLIEEVGRWGCMKQTGVSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDERDFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPDFNIYGDPSFTFPYVPSHL 756
            +K ++  ++++ I+ V     ++ T   + Y    G      +LL S ++L +ELP+RIA R     +LP+ +   P +L V + Y+ +F+ L  FP I+  +DE  + Q+++ +   H +VV ++A GL++ +K +      ED   +  FLD+   SR+GIRML   H+ LH     P  +G I T++SP ++     + AR +C  +YG+AP   I G  +  FP++P  L
Sbjct:   47 SKTVTSFYNQSAIDVVAEKPSVRLTPTMMLYS---GRSQDGSHLLKSGRYLQQELPVRIAHRIKGFRSLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLDDHKDVVTLLAEGLRESRKHI------EDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDK--PDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPMPL 269          
BLAST of DR405941 vs. ExPASy Swiss-Prot
Match: BCKD_HUMAN ([3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Homo sapiens GN=BCKDK PE=1 SV=2)

HSP 1 Score: 125.561 bits (314), Expect = 3.080e-28
Identity = 72/234 (30.77%), Postives = 125/234 (53.42%), Query Frame = 1
Query:   55 AKKLSETFSKTLIEEVGRWGCMKQTGVSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDERDFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPDFNIYGDPSFTFPYVPSHL 756
            +K ++  ++++ I+       ++ T   + Y    G      +LL SA++L +ELP+RIA R      LP+ +   P +L V + Y+ +F+ L  FP I+  +DE  + Q+++ +   H +VV ++A GL++ +K +      ED   +  FLD+   SR+GIRML   H+ LH     P  +G I T++SP ++     + AR +C  +YG+AP   I G  +  FP++P  L
Sbjct:   47 SKTVTSFYNQSAIDAAAEKPSVRLTPTMMLYA---GRSQDGSHLLKSARYLQQELPVRIAHRIKGFRCLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLDDHKDVVTLLAEGLRESRKHI------EDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDK--PDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPMPL 269          
BLAST of DR405941 vs. ExPASy Swiss-Prot
Match: BCKD_BOVIN ([3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Bos taurus GN=BCKDK PE=2 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 6.861e-28
Identity = 69/203 (33.99%), Postives = 113/203 (55.67%), Query Frame = 1
Query:  148 MMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDERDFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPDFNIYGDPSFTFPYVPSHL 756
            M+  G      +LL SA++L +ELP+RIA R     +LP+ +   P +L V + Y+ +F+ L  FP I+  +DE  + Q+++ +   H +VV ++A GL++ +K +      ED   +  FLD+   SR+GIRML   H+ LH     P  +G I T++SP ++     + AR +C  +YG+AP   I G  +  FP++P  L
Sbjct:   75 MLYSGRSQDGSHLLKSARYLQQELPVRIAHRIKGFRSLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEARYCQLVRQLLDDHKDVVTLLAEGLRESRKYI------EDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDK--PDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPMPL 269          
BLAST of DR405941 vs. ExPASy Swiss-Prot
Match: BCKD_MOUSE ([3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Mus musculus GN=Bckdk PE=1 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.528e-27
Identity = 67/203 (33.00%), Postives = 112/203 (55.17%), Query Frame = 1
Query:  148 MMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDERDFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPDFNIYGDPSFTFPYVPSHL 756
            M+  G      +LL S ++L +ELP+RIA R     +LP+ +   P +L V + Y+ +F+ L  FP I+  +DE  + Q+++ +   H +VV ++A GL++ +K +      +D   +  FLD+   SR+GIRML   H+ LH     P  +G I T++SP ++     + AR +C  +YG+AP   I G  +  FP++P  L
Sbjct:   75 MLYSGRSQDGSHLLKSGRYLQQELPVRIAHRIKGFRSLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLDDHKDVVTLLAEGLRESRKHI------QDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDK--PDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPMPL 269          
BLAST of DR405941 vs. ExPASy Swiss-Prot
Match: PDK_DROME ([Pyruvate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Drosophila melanogaster GN=Pdk PE=2 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 2.882e-26
Identity = 80/221 (36.20%), Postives = 113/221 (51.13%), Query Frame = 1
Query:  133 VSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDE-RDFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELH--NPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPDFNIY---GDPSFTFP----YVPSHLHLM 765
            +S++  M+FG    +K   I   FL KELP+R+A    E+  LP  L    +V +V  WY+ SF D+  +     T D  + F   +  I+ RHN+VV  MA G+ ++K+    ++       I  FLDR YMSRI IRMLI QH  L   NP+     IG +D       V R+A E+AR +C + Y ++P   I     +P    P    YVPSHL+ M
Sbjct:   33 LSIKQFMDFGQNACEKKSYI---FLRKELPVRLANIMKEIALLPDNLLHTRSVSEVSSWYVKSFEDVLVYEKAEPTHDNLQKFVADLDLIRNRHNDVVQTMAQGVIEMKENEGGQVDAPTESSIQYFLDRLYMSRISIRMLINQHTLLFGGNPHAGGRHIGCLDPACDLSDVVRDAYENARFLCDQYYLTSPALEIQQHSSEPGDNLPIRTVYVPSHLYYM 250          
BLAST of DR405941 vs. ExPASy Swiss-Prot
Match: PDK4_MOUSE ([Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial OS=Mus musculus GN=Pdk4 PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.095e-25
Identity = 81/253 (32.02%), Postives = 130/253 (51.38%), Query Frame = 1
Query:   43 AAMAAKKLSETFSKTLI-EEVGRWGCMKQTGVSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDER---DFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNPP--PHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPDFNI------YGDPSFTFPYVPSHLHLM 765
            A    +  S   S +L+  EV  +     + +S++ +++FGS+   +    S  FL +ELP+R+A    E++ LP  L   P+V  V+ WY+ S  DL  F + +S  D++   +F   +  ++ RH+NVVP MA G+ + K       V      +  FLDRFYM+RI  RML+ QH+ + + +    P  IG ID     V V ++A E A+ +C + Y ++P+ N+      +        YVPSHLH M
Sbjct:    4 ARFVMRSASSLSSASLVPREVELFSRYSPSPLSMKQLLDFGSENACERT--SFAFLRQELPVRLANILKEIDILPDRLVNTPSVQLVKSWYIQSLMDLVEFHE-KSPEDQKALSEFVDTLVKVRNRHHNVVPTMAQGILEYKDTCTVDPVTN--QNLQYFLDRFYMNRISTRMLMNQHILIFSDSKTGNPSHIGSIDPNCDVVAVVQDAFECAKMLCDQYYLTSPELNLTQVNGKFPGQPIHIVYVPSHLHHM 251          
BLAST of DR405941 vs. ExPASy Swiss-Prot
Match: PDK2_MOUSE ([Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial OS=Mus musculus GN=Pdk2 PE=1 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.431e-25
Identity = 91/263 (34.60%), Postives = 128/263 (48.67%), Query Frame = 1
Query:   19 FVRKQKPEAAMA-AKKLSETFSKTLIEEVGRWGCMKQTGVSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDER---DFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELH----NPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPDFNIY------GDPSFTFPYVPSHLHLM 765
            +VR     A++A A K  E FSK              + +S++  ++FGS    +    S  FL +ELP+R+A    E+  LP  +   P+V  V+ WY+ S  D+  F D +   D R    FT  +  I+ RHN+VVP MA G+ + K       V      I  FLDRFY+SRI IRMLI QH  +     NP  P H IG ID   S   V ++A + A+ +C + Y ++PD  I        +      YVPSHL+ M
Sbjct:    3 WVRALLKNASLAGAPKYIEHFSK-----------FSPSPLSMKQFLDFGSSNACEKT--SFTFLRQELPVRLANIMKEINLLPDRVLGTPSVQLVQSWYVQSLLDIMEFLD-KDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSN--QNIQYFLDRFYLSRISIRMLINQHTLIFDGSTNPAHPKH-IGSIDPNCSVSDVVKDAYDMAKLLCDKYYMASPDLEIQEVNATNANQPIHMVYVPSHLYHM 248          
BLAST of DR405941 vs. ExPASy Swiss-Prot
Match: PDK4_HUMAN ([Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial OS=Homo sapiens GN=PDK4 PE=1 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.868e-25
Identity = 78/234 (33.33%), Postives = 122/234 (52.14%), Query Frame = 1
Query:   97 EVGRWGCMKQTGVSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDER---DFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNPP--PHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPDFNI------YGDPSFTFPYVPSHLHLM 765
            EV  +     + +S++ +++FGS+   +    S  FL +ELP+R+A    E++ LP  L    +V  V+ WY+ S  DL  F + +S  D++   DF   +  ++ RH+NVVP MA G+ + K       V      +  FLDRFYM+RI  RML+ QH+ + + +    P  IG ID     V V ++A E +R +C + Y S+P+  +      + D      YVPSHLH M
Sbjct:   23 EVEHFSRYSPSPLSMKQLLDFGSENACERT--SFAFLRQELPVRLANILKEIDILPTQLVNTSSVQLVKSWYIQSLMDLVEFHE-KSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIEYKDACTVDPVTN--QNLQYFLDRFYMNRISTRMLMNQHILIFSDSQTGNPSHIGSIDPNCDVVAVVQDAFECSRMLCDQYYLSSPELKLTQVNGKFPDQPIHIVYVPSHLHHM 251          
BLAST of DR405941 vs. ExPASy Swiss-Prot
Match: PDK2_RAT ([Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial OS=Rattus norvegicus GN=Pdk2 PE=1 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.868e-25
Identity = 83/224 (37.05%), Postives = 116/224 (51.79%), Query Frame = 1
Query:  133 VSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDER---DFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELH----NPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPDFNI--YGDPSFTFP----YVPSHLHLM 765
            +S++  ++FGS    +    S  FL +ELP+R+A    E+  LP  +   P+V  V+ WY+ S  D+  F D +   D R    FT  +  I+ RHN+VVP MA G+ + K       V      I  FLDRFY+SRI IRMLI QH  +     NP  P H IG ID   S   V ++A + A+ +C + Y ++PD  I      + T P    YVPSHL+ M
Sbjct:   31 LSMKQFLDFGSSNACEKT--SFTFLRQELPVRLANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLD-KDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSN--QNIQYFLDRFYLSRISIRMLINQHTLIFDGSTNPAHPKH-IGSIDPNCSVSDVVKDAYDMAKLLCDKYYMASPDLEIQEVNATNATQPIHMVYVPSHLYHM 248          
BLAST of DR405941 vs. ExPASy Swiss-Prot
Match: PDK4_RAT ([Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial OS=Rattus norvegicus GN=Pdk4 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 2.440e-25
Identity = 75/222 (33.78%), Postives = 117/222 (52.70%), Query Frame = 1
Query:  133 VSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDER---DFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNPP--PHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPDFNI------YGDPSFTFPYVPSHLHLM 765
            +S++ +++FGS+   +    S  FL +ELP+R+A    E++ LP  L   P+V  V+ WY+ S  DL  F + +S  D++   DF   +  ++ RH+NVVP MA G+ + K       V      +  FLDRFYM+RI  RML+ QH+ + + +    P  IG ID     V V  +A E A+ +C + Y ++P+  +      +        YVPSHLH M
Sbjct:   35 LSMKQLLDFGSENACERTSFS--FLRQELPVRLANILKEIDILPEHLVNTPSVQLVKSWYIQSLMDLVEFHE-KSPEDQKVLSDFVDTLVKVRNRHHNVVPTMAQGILEYKDNCTVDPVTN--QNLQYFLDRFYMNRISTRMLMNQHILIFSDSKTGNPSHIGSIDPNCDVVAVVEDAFECAKMLCDQYYLTSPELKLTQVNGKFPGQPIHIVYVPSHLHHM 251          
The following BLAST results are available for this feature:
BLAST of DR405941 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 21
Match NameE-valueIdentityDescription
BCKD_RAT2.358e-2830.77[3-methyl-2-oxobutanoate dehydrogenase [lipoamide]... [more]
BCKD_HUMAN3.080e-2830.77[3-methyl-2-oxobutanoate dehydrogenase [lipoamide]... [more]
BCKD_BOVIN6.861e-2833.99[3-methyl-2-oxobutanoate dehydrogenase [lipoamide]... [more]
BCKD_MOUSE1.528e-2733.00[3-methyl-2-oxobutanoate dehydrogenase [lipoamide]... [more]
PDK_DROME2.882e-2636.20[Pyruvate dehydrogenase [lipoamide]] kinase, mitoc... [more]
PDK4_MOUSE1.095e-2532.02[Pyruvate dehydrogenase [lipoamide]] kinase isozym... [more]
PDK2_MOUSE1.431e-2534.60[Pyruvate dehydrogenase [lipoamide]] kinase isozym... [more]
PDK4_HUMAN1.868e-2533.33[Pyruvate dehydrogenase [lipoamide]] kinase isozym... [more]
PDK2_RAT1.868e-2537.05[Pyruvate dehydrogenase [lipoamide]] kinase isozym... [more]
PDK4_RAT2.440e-2533.78[Pyruvate dehydrogenase [lipoamide]] kinase isozym... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248E01 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248E01 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR405941 ID=DR405941|Name=DR405941|organism=Citrus sinensis|type=EST|length=768bp
GGGGAGGAATTGGATTTTTTTGTGAGAAAGCAGAAGCCAGAAGCAGCAAT
GGCTGCTAAGAAATTGTCGGAGACGTTTTCGAAGACCTTGATCGAGGAGG
TTGGGCGATGGGGATGCATGAAACAGACAGGTGTGAGCTTGAGGTACATG
ATGGAGTTTGGCTCAAAACCTACAGACAAGAATTTGCTAATTTCTGCTCA
GTTTCTTCACAAAGAGCTTCCAATTAGAATCGCCAGACGAGCAATTGAGC
TCGAGACACTTCCTTACGGTTTATCCGAGAAGCCTGCCGTTTTGAAGGTT
CGAGACTGGTATTTGGACTCATTTCGTGATTTGAGGTCGTTTCCTGACAT
CAGAAGTACGAGTGATGAGAGGGATTTTACGCAAATGATTAAGGCGATTA
AGGTGAGGCATAATAATGTGGTGCCCATGATGGCGTTGGGGCTGCAACAA
TTGAAGAAAGAGATGGATCCCAAGATTGTTTACGAGGATCTTGATGAGAT
TCATCAGTTTCTGGATCGGTTTTACATGTCTAGGATCGGAATTCGTATGC
TTATTGGGCAGCATGTAGAATTGCACAATCCCAACCCTCCACCTCATTGT
ATTGGCTACATAGACACAAAAATGTCTCCAGTGCAGGTTGCTAGGAATGC
TAGTGAGCATGCACGTTGTGTTTGTCTGCGGGAGTATGGCAGTGCACCCG
ATTTTAATATCTACGGTGATCCCAGTTTTACATTCCCTTACGTCCCTTCA
CACTTGCATCTCATGGGT
back to top