CX069953
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX069953 vs. ExPASy Swiss-Prot
Match: PSAEA_NICSY (Photosystem I reaction center subunit IV A, chloroplastic OS=Nicotiana sylvestris GN=PSAEA PE=1 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.554e-13 Identity = 34/36 (94.44%), Postives = 35/36 (97.22%), Query Frame = -1 Query: 205 DQDPKSRYPVVVRFNKVNYANVSTNNYALDEIEEVK 312 DQDP +RYPVVVRFNKVNYANVSTNNYALDEIEEVK Sbjct: 106 DQDPNTRYPVVVRFNKVNYANVSTNNYALDEIEEVK 141
BLAST of CX069953 vs. ExPASy Swiss-Prot
Match: PSAEB_NICSY (Photosystem I reaction center subunit IV B, chloroplastic OS=Nicotiana sylvestris GN=PSAEB PE=1 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 4.642e-13 Identity = 33/36 (91.67%), Postives = 35/36 (97.22%), Query Frame = -1 Query: 205 DQDPKSRYPVVVRFNKVNYANVSTNNYALDEIEEVK 312 DQDP +RYPVVVRFNKVNYANVSTNNYALDE+EEVK Sbjct: 108 DQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEEVK 143
BLAST of CX069953 vs. ExPASy Swiss-Prot
Match: PSAE_SPIOL (Photosystem I reaction center subunit IV, chloroplastic OS=Spinacia oleracea GN=PSAE-1 PE=1 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 7.919e-13 Identity = 33/35 (94.29%), Postives = 35/35 (100.00%), Query Frame = -1 Query: 208 DQDPKSRYPVVVRFNKVNYANVSTNNYALDEIEEV 312 DQDPK+RYPVVVRFNKVNYANVSTNNYALDEI+EV Sbjct: 90 DQDPKTRYPVVVRFNKVNYANVSTNNYALDEIQEV 124
BLAST of CX069953 vs. ExPASy Swiss-Prot
Match: PSAE2_ARATH (Photosystem I reaction center subunit IV B, chloroplastic OS=Arabidopsis thaliana GN=PSAE2 PE=1 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.351e-12 Identity = 32/36 (88.89%), Postives = 35/36 (97.22%), Query Frame = -1 Query: 205 DQDPKSRYPVVVRFNKVNYANVSTNNYALDEIEEVK 312 DQDPK+RYPVVVRF KVNYAN+STNNYALDE+EEVK Sbjct: 110 DQDPKTRYPVVVRFAKVNYANISTNNYALDEVEEVK 145
BLAST of CX069953 vs. ExPASy Swiss-Prot
Match: PSAE1_ARATH (Photosystem I reaction center subunit IV A, chloroplastic OS=Arabidopsis thaliana GN=PSAE1 PE=1 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 5.133e-12 Identity = 31/35 (88.57%), Postives = 34/35 (97.14%), Query Frame = -1 Query: 208 DQDPKSRYPVVVRFNKVNYANVSTNNYALDEIEEV 312 DQDPK+RYPVVVRF KVNYAN+STNNYALDE+EEV Sbjct: 107 DQDPKTRYPVVVRFAKVNYANISTNNYALDEVEEV 141 The following BLAST results are available for this feature:
BLAST of CX069953 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 5
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX069953 ID=CX069953; Name=CX069953; organism=Citrus sinensis; type=EST; length=312bpback to top |