CX044131
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX044131 vs. ExPASy Swiss-Prot
Match: RRFC_SPIOL (Ribosome-recycling factor, chloroplastic OS=Spinacia oleracea GN=RRF PE=1 SV=1) HSP 1 Score: 85.1149 bits (209), Expect = 1.998e-16 Identity = 40/45 (88.89%), Postives = 45/45 (100.00%), Query Frame = -1 Query: 370 RDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSIYKQ 504 RDALK+YEKL+KEKKLSEDNVKDLS+DLQKLTDEYMKK++SIYKQ Sbjct: 219 RDALKSYEKLEKEKKLSEDNVKDLSADLQKLTDEYMKKVESIYKQ 263
BLAST of CX044131 vs. ExPASy Swiss-Prot
Match: RRFC_ORYSJ (Ribosome-recycling factor, chloroplastic OS=Oryza sativa subsp. japonica GN=Os07g0570700 PE=2 SV=2) HSP 1 Score: 79.337 bits (194), Expect = 1.096e-14 Identity = 37/45 (82.22%), Postives = 44/45 (97.78%), Query Frame = -1 Query: 370 RDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSIYKQ 504 RDA+KAY+KL+KEKKLSEDNVKDLS+DLQK+TDEYMKKI++I KQ Sbjct: 214 RDAIKAYDKLEKEKKLSEDNVKDLSADLQKVTDEYMKKIEAIQKQ 258
BLAST of CX044131 vs. ExPASy Swiss-Prot
Match: RRFC_ORYSI (Ribosome-recycling factor, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_26546 PE=1 SV=2) HSP 1 Score: 79.337 bits (194), Expect = 1.096e-14 Identity = 37/45 (82.22%), Postives = 44/45 (97.78%), Query Frame = -1 Query: 370 RDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSIYKQ 504 RDA+KAY+KL+KEKKLSEDNVKDLS+DLQK+TDEYMKKI++I KQ Sbjct: 214 RDAIKAYDKLEKEKKLSEDNVKDLSADLQKVTDEYMKKIEAIQKQ 258
BLAST of CX044131 vs. ExPASy Swiss-Prot
Match: RRFC_DAUCA (Ribosome-recycling factor, chloroplastic (Fragment) OS=Daucus carota GN=RRF PE=2 SV=2) HSP 1 Score: 79.337 bits (194), Expect = 1.096e-14 Identity = 36/45 (80.00%), Postives = 44/45 (97.78%), Query Frame = -1 Query: 370 RDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSIYKQ 504 RDA+K+Y+KL+KEKKLSEDNVKDLSSDLQK+ DEY+KK+DSI+KQ Sbjct: 175 RDAIKSYDKLEKEKKLSEDNVKDLSSDLQKVIDEYIKKVDSIFKQ 219
BLAST of CX044131 vs. ExPASy Swiss-Prot
Match: RRFC_ARATH (Ribosome-recycling factor, chloroplastic OS=Arabidopsis thaliana GN=RRF PE=1 SV=2) HSP 1 Score: 78.1814 bits (191), Expect = 2.443e-14 Identity = 37/45 (82.22%), Postives = 42/45 (93.33%), Query Frame = -1 Query: 370 RDALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSIYKQ 504 RDALK+Y+KL+KEKKLSEDNVKDLSSDLQKL D YMKKI+ +YKQ Sbjct: 223 RDALKSYDKLEKEKKLSEDNVKDLSSDLQKLIDVYMKKIEELYKQ 267 The following BLAST results are available for this feature:
BLAST of CX044131 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 5
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX044131 ID=CX044131; Name=CX044131; organism=Citrus sinensis; type=EST; length=504bpback to top |