DN134780

Overview
NameDN134780
Unique NameDN134780
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length569
Libraries
Library NameType
Developing fruit albedo at 80 DAFB in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1825 contig Csv1_Contig1825:18..585. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN134780 vs. ExPASy Swiss-Prot
Match: RS23_FRAAN (40S ribosomal protein S23 OS=Fragaria ananassa GN=RPS23 PE=2 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 2.481e-75
Identity = 138/140 (98.57%), Postives = 139/140 (99.29%), Query Frame = 1
Query:   88 KTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 507
            KTRGMGA RKLK+HRRRQRWADKSYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct:    3 KTRGMGAARKLKNHRRRQRWADKSYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 142          
BLAST of DN134780 vs. ExPASy Swiss-Prot
Match: RS23_EUPES (40S ribosomal protein S23 OS=Euphorbia esula GN=RPS23 PE=2 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 2.100e-74
Identity = 137/140 (97.86%), Postives = 137/140 (97.86%), Query Frame = 1
Query:   88 KTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 507
            KT GMGA RKLKSHRR QRWADKSYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct:    3 KTHGMGAARKLKSHRRTQRWADKSYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 142          
BLAST of DN134780 vs. ExPASy Swiss-Prot
Match: RS232_ARATH (40S ribosomal protein S23-2 OS=Arabidopsis thaliana GN=RPS23B PE=2 SV=2)

HSP 1 Score: 271.937 bits (694), Expect = 1.505e-72
Identity = 135/140 (96.43%), Postives = 135/140 (96.43%), Query Frame = 1
Query:   88 KTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 507
            KTRGMGAGRKLK  R  QRWADK YKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct:    3 KTRGMGAGRKLKRLRINQRWADKQYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 142          
BLAST of DN134780 vs. ExPASy Swiss-Prot
Match: RS231_ARATH (40S ribosomal protein S23-1 OS=Arabidopsis thaliana GN=RPS23A PE=2 SV=2)

HSP 1 Score: 263.077 bits (671), Expect = 6.992e-70
Identity = 132/140 (94.29%), Postives = 133/140 (95.00%), Query Frame = 1
Query:   88 KTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 507
            KTRGMGAGRKLK  R  QRWADK YKKS+ GNEWKKPFA SSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS
Sbjct:    3 KTRGMGAGRKLKQLRITQRWADKHYKKSNRGNEWKKPFACSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 142          
BLAST of DN134780 vs. ExPASy Swiss-Prot
Match: RS23_LUMRU (40S ribosomal protein S23 OS=Lumbricus rubellus GN=RPS23 PE=2 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 1.412e-62
Identity = 114/141 (80.85%), Postives = 125/141 (88.65%), Query Frame = 1
Query:   88 KTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWKK-PFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 507
            K RG+   RKLK+HRR QRW DK YKKSHLG  WK  PF G+SHAKGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLN+IEENDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+K+KKE+PRS
Sbjct:    3 KPRGLRTARKLKNHRREQRWHDKDYKKSHLGTRWKSNPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNFIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVASVSLLALYKQKKERPRS 143          
BLAST of DN134780 vs. ExPASy Swiss-Prot
Match: RS23_DERVA (40S ribosomal protein S23 OS=Dermacentor variabilis GN=RpS23 PE=2 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 5.366e-62
Identity = 114/141 (80.85%), Postives = 124/141 (87.94%), Query Frame = 1
Query:   88 KTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 507
            K RG+   RK +SHRR QRW DK YKK+HLG  WK  PF G+SHAKGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DGCLNYIEENDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct:    3 KPRGLRTARKHRSHRRDQRWHDKDYKKAHLGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 143          
BLAST of DN134780 vs. ExPASy Swiss-Prot
Match: RS23_SPOFR (40S ribosomal protein S23 OS=Spodoptera frugiperda GN=RpS23 PE=2 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 4.542e-61
Identity = 111/141 (78.72%), Postives = 124/141 (87.94%), Query Frame = 1
Query:   88 KTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 507
            K RG+   RK  +HRR QRWADK YKK+H+G  WK  PF G+SHAKGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKK+ AFVP DGCLN+IEENDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct:    3 KPRGIRTARKHVNHRREQRWADKDYKKAHMGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 143          
BLAST of DN134780 vs. ExPASy Swiss-Prot
Match: RS23_PAPDA (40S ribosomal protein S23 OS=Papilio dardanus GN=RpS23 PE=2 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 4.542e-61
Identity = 111/141 (78.72%), Postives = 124/141 (87.94%), Query Frame = 1
Query:   88 KTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 507
            K RG+   RK  +HRR QRWADK YKK+H+G  WK  PF G+SHAKGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKK+ AFVP DGCLN+IEENDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct:    3 KPRGIRTARKHVNHRREQRWADKDYKKAHMGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 143          
BLAST of DN134780 vs. ExPASy Swiss-Prot
Match: RS23_DROME (40S ribosomal protein S23 OS=Drosophila melanogaster GN=RpS23 PE=2 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.012e-60
Identity = 113/141 (80.14%), Postives = 123/141 (87.23%), Query Frame = 1
Query:   88 KTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 507
            K RG+   RK  +HRR QRWADK YKK+HLG  WK  PF G+SHAKGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVP DG LNYIEENDEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct:    3 KPRGLRTARKHVNHRRDQRWADKDYKKAHLGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGSLNYIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 143          
BLAST of DN134780 vs. ExPASy Swiss-Prot
Match: RS23_BRUMA (40S ribosomal protein S23 OS=Brugia malayi GN=rps-23 PE=2 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 1.726e-60
Identity = 110/141 (78.01%), Postives = 124/141 (87.94%), Query Frame = 1
Query:   88 KTRGMGAGRKLKSHRRRQRWADKSYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 507
            K +G+ A RKLK+HR+ QRW DK YKK+HLG  WK  PF  +SHAKGIVLEK+G+EAKQPNSAIRKC RVQLIKNGKKI AFVPNDGCLN+IEENDEVL+AGFGRKGHAVGDIPGVRFK+VKV+  SL+ALFK KKE+PRS
Sbjct:    3 KPKGIRAARKLKTHRQAQRWNDKGYKKAHLGTRWKANPFGTASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGRKGHAVGDIPGVRFKIVKVANTSLIALFKGKKERPRS 143          
The following BLAST results are available for this feature:
BLAST of DN134780 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 78
Match NameE-valueIdentityDescription
RS23_FRAAN2.481e-7598.5740S ribosomal protein S23 OS=Fragaria ananassa GN=... [more]
RS23_EUPES2.100e-7497.8640S ribosomal protein S23 OS=Euphorbia esula GN=RP... [more]
RS232_ARATH1.505e-7296.4340S ribosomal protein S23-2 OS=Arabidopsis thalian... [more]
RS231_ARATH6.992e-7094.2940S ribosomal protein S23-1 OS=Arabidopsis thalian... [more]
RS23_LUMRU1.412e-6280.8540S ribosomal protein S23 OS=Lumbricus rubellus GN... [more]
RS23_DERVA5.366e-6280.8540S ribosomal protein S23 OS=Dermacentor variabili... [more]
RS23_SPOFR4.542e-6178.7240S ribosomal protein S23 OS=Spodoptera frugiperda... [more]
RS23_PAPDA4.542e-6178.7240S ribosomal protein S23 OS=Papilio dardanus GN=R... [more]
RS23_DROME1.012e-6080.1440S ribosomal protein S23 OS=Drosophila melanogast... [more]
RS23_BRUMA1.726e-6078.0140S ribosomal protein S23 OS=Brugia malayi GN=rps-... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionwca01b11 Developing fruit albedo at 80 DAFB in Vulnus5 vector Citrus sinensis cDNA clone wca01b11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN134780 ID=DN134780|Name=DN134780|organism=Citrus sinensis|type=EST|length=569bp
CGGCCGGGGGCGGCGTCCTCTTGCACTCTCAAGCTCCAATGTCGTTCGTT
ACATTCAAAAATCCTCTTCGTAACGCCAACANNNNGGAAGACACGTGGAA
TGGGAGCGGGTCGCAAGCTGAAGAGCCACCGAAGAAGACAAAGGTGGGCT
GATAAGTCATACAAGAAATCCCACCTTGGCAATGAATGGAAGAAGCCATT
TGCTGGCTCTTCCCATGCAAAAGGCATTGTTCTTGAGAAAATCGGTATCG
AGGCAAAGCAGCCCAACTCCGCTATCAGAAAATGTGCTCGAGTTCAGCTG
ATCAAGAATGGAAAGAAGATTGCAGCTTTCGTACCAAACGATGGTTGTTT
GAACTACATTGAAGAAAATGACGAGGTACTTATTGCAGGATTTGGTCGAA
AGGGGCATGCTGTGGGAGATATTCCTGGTGTTAGATTTAAGGTTGTCAAG
GTTTCAGGCGTGTCTCTTCTGGCCCTCTTCAAGGAGAAGAAGGAGAAACC
AAGATCCTAAACTCCTGATTCAAGATACTTCACCATGTTTTCTTTTTTTA
GCACTTTATTTTCATTAAT
back to top