DC900402

Overview
NameDC900402
Unique NameDC900402
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length528
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900402 vs. ExPASy Swiss-Prot
Match: SCL1_ARATH (Scarecrow-like protein 1 OS=Arabidopsis thaliana GN=SCL1 PE=2 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 1.904e-36
Identity = 74/95 (77.89%), Postives = 83/95 (87.37%), Query Frame = 2
Query:   20 EXRMNVERQCLARDIVNIIACEGEERIERYELAGKWRARMTMAGFTSCPMSADVTDMIRKLIK-QYCDRYKLKEELGLLHFGWEDKSLIVASAWK 301
            + RMNVERQCLARDIVNI+ACEGEERIERYE AGKWRARM MAGF   PMSA VT+ I+ LIK QYC++YKLKEE+G LHF WE+KSLIVASAW+
Sbjct:  499 QERMNVERQCLARDIVNIVACEGEERIERYEAAGKWRARMMMAGFNPKPMSAKVTNNIQNLIKQQYCNKYKLKEEMGELHFCWEEKSLIVASAWR 593          
BLAST of DC900402 vs. ExPASy Swiss-Prot
Match: PAT1_ARATH (Scarecrow-like transcription factor PAT1 OS=Arabidopsis thaliana GN=PAT1 PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 3.047e-26
Identity = 51/95 (53.68%), Postives = 70/95 (73.68%), Query Frame = 2
Query:   17 HEXRMNVERQCLARDIVNIIACEGEERIERYELAGKWRARMTMAGFTSCPMSADVTDMIRKLIKQYCDRYKLKEELGLLHFGWEDKSLIVASAWK 301
            H+ R+NVE+ CLARD+VNIIACEG +R+ER+EL GKWR+R  MAGFT  P+S  V   I+ L++ Y D+Y+L+E  G L+ GW  + L+ + AWK
Sbjct:  396 HKQRINVEQHCLARDVVNIIACEGADRVERHELLGKWRSRFGMAGFTPYPLSPLVNSTIKSLLRNYSDKYRLEERDGALYLGWMHRDLVASCAWK 490          
BLAST of DC900402 vs. ExPASy Swiss-Prot
Match: CIGR2_ORYSJ (Chitin-inducible gibberellin-responsive protein 2 OS=Oryza sativa subsp. japonica GN=CIGR2 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 6.789e-26
Identity = 53/91 (58.24%), Postives = 69/91 (75.82%), Query Frame = 2
Query:   26 RMNVERQCLARDIVNIIACEGEERIERYELAGKWRARMTMAGFTSCPMSADVTDMIRKLIKQYCDRYKLKEELGLLHFGWEDKSLIVASAW 298
            R+N+E+ CLAR+IVN+IACEGEER ERYE  GKW+AR+TMAGF   P+S+ V   IR L++ Y D YKL E  G L+ GW+ + L+V+SAW
Sbjct:  453 RINMEQHCLAREIVNLIACEGEERAERYEPFGKWKARLTMAGFRPSPLSSLVNATIRTLLQSYSDNYKLAERDGALYLGWKSRPLVVSSAW 543          
BLAST of DC900402 vs. ExPASy Swiss-Prot
Match: CIGR1_ORYSJ (Chitin-inducible gibberellin-responsive protein 1 OS=Oryza sativa subsp. japonica GN=CIGR1 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 5.747e-25
Identity = 51/94 (54.26%), Postives = 72/94 (76.60%), Query Frame = 2
Query:   17 HEXRMNVERQCLARDIVNIIACEGEERIERYELAGKWRARMTMAGFTSCPMSADVTDMIRKLIKQYCDRYKLKEELGLLHFGWEDKSLIVASAW 298
            ++ R++VE+ CLA+DIVNIIACEG++R+ER+EL GKW++R+TMAGF   P+S+ V  +IRKL+  Y D+Y L E+ G +  GW  + LI ASAW
Sbjct:  477 NKERISVEQHCLAKDIVNIIACEGKDRVERHELLGKWKSRLTMAGFRPYPLSSYVNSVIRKLLACYSDKYTLDEKDGAMLLGWRSRKLISASAW 570          
BLAST of DC900402 vs. ExPASy Swiss-Prot
Match: SCL21_ARATH (Scarecrow-like protein 21 OS=Arabidopsis thaliana GN=SCL21 PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 9.803e-25
Identity = 48/95 (50.53%), Postives = 71/95 (74.74%), Query Frame = 2
Query:   17 HEXRMNVERQCLARDIVNIIACEGEERIERYELAGKWRARMTMAGFTSCPMSADVTDMIRKLIKQYCDRYKLKEELGLLHFGWEDKSLIVASAWK 301
            H+ R+N+E+ C+ARD+VNIIACEG ERIER+EL GKW++R +MAGF   P+S+ ++  IR L++ Y + Y ++E  G L+ GW D+ L+ + AWK
Sbjct:  319 HKERINIEQHCMARDVVNIIACEGAERIERHELLGKWKSRFSMAGFEPYPLSSIISATIRALLRDYSNGYAIEERDGALYLGWMDRILVSSCAWK 413          
BLAST of DC900402 vs. ExPASy Swiss-Prot
Match: SCL5_ARATH (Scarecrow-like protein 5 OS=Arabidopsis thaliana GN=SCL5 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.198e-22
Identity = 47/95 (49.47%), Postives = 69/95 (72.63%), Query Frame = 2
Query:   17 HEXRMNVERQCLARDIVNIIACEGEERIERYELAGKWRARMTMAGFTSCPMSADVTDMIRKLIKQYCDRYKLKEELGLLHFGWEDKSLIVASAWK 301
            H+ R+NVE+ CLAR++VN+IACEG ER ER+E  GKWR+R  MAGF   P+S+ V   I+ L++ Y ++Y L+E  G L+ GW+++ LI + AW+
Sbjct:  503 HKERINVEQHCLAREVVNLIACEGVEREERHEPLGKWRSRFHMAGFKPYPLSSYVNATIKGLLESYSEKYTLEERDGALYLGWKNQPLITSCAWR 597          
BLAST of DC900402 vs. ExPASy Swiss-Prot
Match: SCL8_ARATH (Scarecrow-like protein 8 OS=Arabidopsis thaliana GN=SCL8 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 2.676e-14
Identity = 36/84 (42.86%), Postives = 55/84 (65.48%), Query Frame = 2
Query:   50 LARDIVNIIACEGEERIERYELAGKWRARMTMAGFTSCPMSADVTDMIRKLIKQYCDRYKLKEELGLLHFGWEDKSLIVASAWK 301
            + R +VN +ACEG +RIER E+ GKWR RM+MAGF   P+S  + + ++    +    + +KE+ G + FGW  ++L VASAW+
Sbjct:  557 IGRKLVNAVACEGIDRIERCEVFGKWRMRMSMAGFELMPLSEKIAESMKSRGNRVHPGFTVKEDNGGVCFGWMGRALTVASAWR 640          
BLAST of DC900402 vs. ExPASy Swiss-Prot
Match: SCL3_ARATH (Scarecrow-like protein 3 OS=Arabidopsis thaliana GN=SCL3 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.468e-12
Identity = 39/96 (40.62%), Postives = 56/96 (58.33%), Query Frame = 2
Query:   20 EXRMNVERQCLARDIVNIIACEGEERIERYELAGKWRARMTMAGFTSCPMSADVTDMIRKLIKQYC--DRYKLKEELGLLHFGWEDKSLIVASAWK 301
            + R+ VE+     +I NII+CEG ER ER+E   KW  R+ +AGF + P+S       R+L+ Q C  D Y++KEE G     W+D+ L   SAW+
Sbjct:  385 QDRIKVEKMLFGEEIKNIISCEGFERRERHEKLEKWSQRIDLAGFGNVPLSYYAMLQARRLL-QGCGFDGYRIKEESGCAVICWQDRPLYSVSAWR 479          
BLAST of DC900402 vs. ExPASy Swiss-Prot
Match: RGL2_ARATH (DELLA protein RGL2 OS=Arabidopsis thaliana GN=RGL2 PE=1 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 1.918e-12
Identity = 34/86 (39.53%), Postives = 49/86 (56.98%), Query Frame = 2
Query:   50 LARDIVNIIACEGEERIERYELAGKWRARMTMAGFTSCPMSADVTDMIRKLIKQYC--DRYKLKEELGLLHFGWEDKSLIVASAWK 301
            L R I+N++A EG +R+ER+E A +WR RM  AGF    + +        L+  Y   D Y+++E  G L  GW+ + LI  SAWK
Sbjct:  460 LGRQILNVVAAEGSDRVERHETAAQWRIRMKSAGFDPIHLGSSAFKQASMLLSLYATGDGYRVEENDGCLMIGWQTRPLITTSAWK 545          
BLAST of DC900402 vs. ExPASy Swiss-Prot
Match: SLN1_HORVU (DELLA protein SLN1 OS=Hordeum vulgare GN=SLN1 PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 3.271e-12
Identity = 34/86 (39.53%), Postives = 50/86 (58.14%), Query Frame = 2
Query:   50 LARDIVNIIACEGEERIERYELAGKWRARMTMAGFTSCPMSADVTDMIRKLIKQYC--DRYKLKEELGLLHFGWEDKSLIVASAWK 301
            L R I N++ACEG ER ER+E  G+WR R+  AGF +  + ++       L+  +   D YK++E+ G L  GW  + LI  SAW+
Sbjct:  529 LGRQICNVVACEGTERTERHETLGQWRNRLGNAGFETVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWR 614          
The following BLAST results are available for this feature:
BLAST of DC900402 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
SCL1_ARATH1.904e-3677.89Scarecrow-like protein 1 OS=Arabidopsis thaliana G... [more]
PAT1_ARATH3.047e-2653.68Scarecrow-like transcription factor PAT1 OS=Arabid... [more]
CIGR2_ORYSJ6.789e-2658.24Chitin-inducible gibberellin-responsive protein 2 ... [more]
CIGR1_ORYSJ5.747e-2554.26Chitin-inducible gibberellin-responsive protein 1 ... [more]
SCL21_ARATH9.803e-2550.53Scarecrow-like protein 21 OS=Arabidopsis thaliana ... [more]
SCL5_ARATH1.198e-2249.47Scarecrow-like protein 5 OS=Arabidopsis thaliana G... [more]
SCL8_ARATH2.676e-1442.86Scarecrow-like protein 8 OS=Arabidopsis thaliana G... [more]
SCL3_ARATH1.468e-1240.63Scarecrow-like protein 3 OS=Arabidopsis thaliana G... [more]
RGL2_ARATH1.918e-1239.53DELLA protein RGL2 OS=Arabidopsis thaliana GN=RGL2... [more]
SLN1_HORVU3.271e-1239.53DELLA protein SLN1 OS=Hordeum vulgare GN=SLN1 PE=1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900402 VSS Citrus sinensis cDNA clone VS28977 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900402 ID=DC900402|Name=DC900402|organism=Citrus sinensis|type=EST|length=528bp
CTCGTGCCGAATTCGGCACGAGNATAGAATGAACGTCGAACGGCAATGCC
TGGCACGTGACATTGTTAACATCATTGCATGTGAGGGAGAGGAACGGATA
GAACGGTATGAGCTTGCAGGGAAATGGAGGGCAAGGATGACCATGGCTGG
GTTCACTTCATGCCCAATGAGTGCTGATGTGACTGATATGATTCGGAAAC
TTATAAAGCAATACTGTGACAGGTACAAGTTGAAGGAGGAATTGGGTCTA
CTGCATTTTGGGTGGGAAGACAAAAGCTTGATCGTTGCTTCTGCATGGAA
GTAGCAAGTACAATTCTGGATTTTTTCGTTTTCGTTTCCCCTTTTTTTTT
TTTTTCATTTTTTTACCGAGTGATAGTTGTAAAATATTTTTCGGTGGTTG
TCCACTTGATATTTCATTTAGATTGAGGTTGAAGAACGAAGAAGCTTGTT
AATGTTTTGCTAATGTAAATTTCGCTGATGATTGGGCTTGCTGATTATCT
AACGTTTATGAATAATTTATTCTGCTGC
back to top