DC900398

Overview
NameDC900398
Unique NameDC900398
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length602
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4027 contig Csv1_Contig4027:505..1106. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: Y1461_ARATH (Probable serine/threonine-protein kinase At1g54610 OS=Arabidopsis thaliana GN=At1g54610 PE=1 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 7.772e-102
Identity = 177/200 (88.50%), Postives = 189/200 (94.50%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            KIVALKKVRFDNLEPESVKFMAREIL+LRRLDHPNV+KLEGLVTSRMSCSLYLVF YM+HDLAGL +SP VKF+E +VKC M QL+SGLEHCH+ GVLHRDIKGSNLLIDD GVLKIADFGLA+ FDPNHK PMTSRVVTLWYR PELLLGATDYGVG+DLWSAGCILAELLAG+PIMPGRTEVEQLHKIYKLCGSPSE+
Sbjct:  142 KIVALKKVRFDNLEPESVKFMAREILVLRRLDHPNVVKLEGLVTSRMSCSLYLVFQYMDHDLAGLASSPVVKFSESEVKCLMRQLISGLEHCHSRGVLHRDIKGSNLLIDDGGVLKIADFGLATIFDPNHKRPMTSRVVTLWYRAPELLLGATDYGVGIDLWSAGCILAELLAGRPIMPGRTEVEQLHKIYKLCGSPSED 341          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDKC2_ARATH (Cyclin-dependent kinase C-2 OS=Arabidopsis thaliana GN=CDKC-2 PE=1 SV=2)

HSP 1 Score: 247.669 bits (631), Expect = 3.410e-65
Identity = 126/214 (58.88%), Postives = 155/214 (72.43%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTS--------------RMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSE 598
            +IVALKK+R DN E E     A REI IL++L H NVI L+ +VTS              +    +Y+VF YM+HDL GL   P ++FT PQ+KCYM QLL+GL +CH N VLHRDIKGSNLLID++G LK+ADFGLA  +  +H   +T+RV+TLWYRPPELLLGAT YG  +D+WS GCI AELL GKPI+PG+TE EQL+KIY+LCGSP E
Sbjct:   50 EIVALKKIRMDN-EREGFPITAIREIKILKKLHHENVIHLKEIVTSPGRDRDDQGKPDNNKYKGGIYMVFEYMDHDLTGLADRPGLRFTVPQIKCYMKQLLTGLHYCHVNQVLHRDIKGSNLLIDNEGNLKLADFGLARSYSHDHTGNLTNRVITLWYRPPELLLGATKYGPAIDMWSVGCIFAELLNGKPILPGKTENEQLNKIYELCGSPDE 262          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDKC1_ORYSJ (Cyclin-dependent kinase C-1 OS=Oryza sativa subsp. japonica GN=CDKC-1 PE=2 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 6.432e-64
Identity = 124/215 (57.67%), Postives = 154/215 (71.63%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTS---------------RMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSE 598
            +IVALKK+R DN E E     A REI IL++L H NVI+L+ +VTS               +   S+Y+VF YM+HDL GL   P ++FT PQ+KCYM QLL+GL +CH N VLHRDIKGSNLLID++G LK+ADFGLA  F  +H   +T+RV+TLWYRPPELLLG+T YG  VD+WS GCI AELL GKPI+PG+ E EQL KI+ +CG+P E
Sbjct:   49 EIVALKKIRMDN-EREGFPITAIREIKILKKLHHQNVIQLKEIVTSPGPERDEQGKPIHGNKYKGSIYMVFEYMDHDLTGLADRPGMRFTVPQIKCYMKQLLTGLHYCHINQVLHRDIKGSNLLIDNEGNLKLADFGLARSFSNDHNGNLTNRVITLWYRPPELLLGSTKYGPAVDMWSVGCIFAELLNGKPILPGKNEPEQLSKIFDVCGTPDE 262          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDKC1_ARATH (Cyclin-dependent kinase C-1 OS=Arabidopsis thaliana GN=CDKC-1 PE=1 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 6.432e-64
Identity = 123/215 (57.21%), Postives = 155/215 (72.09%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTS--------------RMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +IVALKK+R DN E E     A REI IL++L H NVI+L+ +VTS              +    +Y+VF YM+HDL GL   P ++FT PQ+KCYM QLL+GL +CH N VLHRDIKGSNLLID++G LK+ADFGLA  +  +H   +T+RV+TLWYRPPELLLGAT YG  +D+WS GCI AELL  KPI+PG+ E EQL+KI++LCGSP E+
Sbjct:   50 EIVALKKIRMDN-EREGFPITAIREIKILKKLHHENVIQLKEIVTSPGRDRDDQGKPDNNKYKGGIYMVFEYMDHDLTGLADRPGLRFTVPQIKCYMKQLLTGLHYCHVNQVLHRDIKGSNLLIDNEGNLKLADFGLARSYSHDHTGNLTNRVITLWYRPPELLLGATKYGPAIDMWSVGCIFAELLHAKPILPGKNEQEQLNKIFELCGSPDEK 263          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDKC2_ORYSJ (Cyclin-dependent kinase C-2 OS=Oryza sativa subsp. japonica GN=CDKC-2 PE=2 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.097e-63
Identity = 124/215 (57.67%), Postives = 154/215 (71.63%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTS---------------RMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSE 598
            +IVALKK+R DN E E     A REI IL++L H NVI+L+ +VTS               +   S+Y+VF YM+HDL GL   P ++FT PQ+KCYM QLL+GL +CH N VLHRDIKGSNLLID++G LK+ADFGLA  F  +H   +T+RV+TLWYRPPELLLG+T YG  VD+WS GCI AELL GKPI+ G+ E EQL KI++LCG+P E
Sbjct:   49 EIVALKKIRMDN-EREGFPITAIREIKILKKLHHQNVIQLKEIVTSPGPERDEQGKPIEGNKYKGSIYMVFEYMDHDLTGLADRPGMRFTVPQIKCYMRQLLTGLHYCHVNQVLHRDIKGSNLLIDNEGNLKLADFGLARSFSSDHNGNLTNRVITLWYRPPELLLGSTRYGPAVDMWSVGCIFAELLNGKPILTGKNEPEQLSKIFELCGTPDE 262          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK12_HUMAN (Cell division protein kinase 12 OS=Homo sapiens GN=CDK12 PE=1 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 5.286e-50
Identity = 101/206 (49.03%), Postives = 133/206 (64.56%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSC--------SLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSP 592
            ++VALKKVR DN E E     A REI ILR+L H +V+ ++ +VT +           + YLVF YM+HDL GL+ S  V F+E  +K +M QL+ GLE+CH    LHRDIK SN+L+++ G +K+ADFGLA  ++     P T++V+TLWYRPPELLLG   Y   +D+WS GCIL EL   KPI     E+ QL  I +LCGSP
Sbjct:  751 ELVALKKVRLDN-EKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSP 955          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK12_RAT (Cell division protein kinase 12 OS=Rattus norvegicus GN=Cdk12 PE=1 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 9.016e-50
Identity = 100/206 (48.54%), Postives = 133/206 (64.56%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSC--------SLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSP 592
            ++VALKKVR DN E E     A REI ILR+L H +V+ ++ +VT +           + YLVF YM+HDL GL+ S  V F+E  +K +M QL+ GL++CH    LHRDIK SN+L+++ G +K+ADFGLA  ++     P T++V+TLWYRPPELLLG   Y   +D+WS GCIL EL   KPI     E+ QL  I +LCGSP
Sbjct:  747 ELVALKKVRLDN-EKEGFPITAIREIKILRQLVHQSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLDYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSP 951          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK12_MOUSE (Cell division protein kinase 12 OS=Mus musculus GN=Cdk12 PE=1 SV=2)

HSP 1 Score: 196.438 bits (498), Expect = 9.016e-50
Identity = 100/206 (48.54%), Postives = 133/206 (64.56%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSC--------SLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSP 592
            ++VALKKVR DN E E     A REI ILR+L H +V+ ++ +VT +           + YLVF YM+HDL GL+ S  V F+E  +K +M QL+ GL++CH    LHRDIK SN+L+++ G +K+ADFGLA  ++     P T++V+TLWYRPPELLLG   Y   +D+WS GCIL EL   KPI     E+ QL  I +LCGSP
Sbjct:  747 ELVALKKVRLDN-EKEGFPITAIREIKILRQLVHQSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLDYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSP 951          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDKC3_ORYSJ (Cyclin-dependent kinase C-3 OS=Oryza sativa subsp. japonica GN=CDKC-1 PE=2 SV=2)

HSP 1 Score: 195.667 bits (496), Expect = 1.538e-49
Identity = 106/211 (50.24%), Postives = 138/211 (65.40%), Query Frame = 2
Query:   11 ALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSC-------------SLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDG-VLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            ALKK++ D+ +    + + REI +L++LDH N+I+L+ +V S  +               +Y+VF YM+HDL  ++       T  QVK YM QLL GL +CH N VLHRDIKG+NLLI   G +LK+ADFGLA  F  +     T+ V+TLWYRPPELLLGAT+Y   VD+WS GCI AE L  KP+ PGRTE EQL KI++LCG P+EE
Sbjct:   54 ALKKIKLDDGKEGFPRQILREIKLLKKLDHENIIRLKEIVVSPGTAHGAGGSDDYMYRGDIYMVFEYMDHDLKKVLHHS----TPSQVKYYMEQLLKGLHYCHVNNVLHRDIKGANLLISGGGKLLKLADFGLARPFTRDGS--FTNHVITLWYRPPELLLGATNYAEAVDIWSVGCIFAEFLLRKPLFPGRTEQEQLSKIFELCGFPNEE 258          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK13_MOUSE (Cell division protein kinase 13 OS=Mus musculus GN=Cdk13 PE=1 SV=2)

HSP 1 Score: 193.741 bits (491), Expect = 5.844e-49
Identity = 99/206 (48.06%), Postives = 131/206 (63.59%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSC--------SLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSP 592
            ++VALKKVR DN E E     A REI ILR+L H ++I ++ +VT +           + YLVF YM+HDL GL+ S  V F E  +K +M QL+ GL++CH    LHRDIK SN+L+++ G +K+ADFGLA  +      P T++V+TLWYRPPELLLG   Y   +D+WS GCIL EL   KPI     E+ QL  I ++CGSP
Sbjct:  729 EMVALKKVRLDN-EKEGFPITAIREIKILRQLTHQSIINMKEIVTDKEDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFNENHIKSFMRQLMEGLDYCHKKNFLHRDIKCSNILLNNRGQIKLADFGLARLYSSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRICGSP 933          
The following BLAST results are available for this feature:
BLAST of DC900398 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
Y1461_ARATH7.772e-10288.50Probable serine/threonine-protein kinase At1g54610... [more]
CDKC2_ARATH3.410e-6558.88Cyclin-dependent kinase C-2 OS=Arabidopsis thalian... [more]
CDKC1_ORYSJ6.432e-6457.67Cyclin-dependent kinase C-1 OS=Oryza sativa subsp.... [more]
CDKC1_ARATH6.432e-6457.21Cyclin-dependent kinase C-1 OS=Arabidopsis thalian... [more]
CDKC2_ORYSJ1.097e-6357.67Cyclin-dependent kinase C-2 OS=Oryza sativa subsp.... [more]
CDK12_HUMAN5.286e-5049.03Cell division protein kinase 12 OS=Homo sapiens GN... [more]
CDK12_RAT9.016e-5048.54Cell division protein kinase 12 OS=Rattus norvegic... [more]
CDK12_MOUSE9.016e-5048.54Cell division protein kinase 12 OS=Mus musculus GN... [more]
CDKC3_ORYSJ1.538e-4950.24Cyclin-dependent kinase C-3 OS=Oryza sativa subsp.... [more]
CDK13_MOUSE5.844e-4948.06Cell division protein kinase 13 OS=Mus musculus GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900398 VSS Citrus sinensis cDNA clone VS28972 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900398 ID=DC900398|Name=DC900398|organism=Citrus sinensis|type=EST|length=602bp
CAAAATCGTAGCACTAAAGAAAGTACGGTTTGACAATTTGGAACCTGAGA
GTGTGAAATTTATGGCTAGAGAGATTCTCATATTGCGGAGATTGGATCAT
CCAAATGTTATAAAGTTGGAAGGTTTAGTGACGTCAAGGATGTCATGTAG
TTTGTACCTGGTATTTCATTATATGGAGCATGATTTGGCTGGACTTGTTG
CAAGCCCTGAAGTGAAGTTCACAGAACCACAGGTTAAATGTTACATGCAT
CAACTGCTATCTGGACTTGAGCACTGTCACAACAATGGTGTGCTTCACCG
GGACATTAAAGGCTCTAATCTTCTAATTGATGATGATGGAGTGCTTAAAA
TAGCTGATTTTGGTTTGGCATCTTTCTTTGATCCAAATCATAAGCATCCT
ATGACTAGTCGAGTGGTTACTCTTTGGTATCGACCTCCTGAGCTGCTTCT
GGGGGCTACTGATTACGGTGTGGGTGTTGATCTATGGAGCGCAGGTTGTA
TTTTAGCTGAGCTACTGGCTGGGAAGCCCATTATGCCTGGTCGTACGGAG
GTAGAGCAACTACATAAGATATATAAGTTATGTGGTTCCCCTTCAGAAGA
AT
back to top