DC900342

Overview
NameDC900342
Unique NameDC900342
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1211
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12689 contig Csv1_Contig12689:61..1271. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB1_THEEB (Chaperone protein clpB 1 OS=Thermosynechococcus elongatus (strain BP-1) GN=clpB1 PE=3 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 3.454e-108
Identity = 193/274 (70.44%), Postives = 234/274 (85.40%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            VVGQD AV +VAEAIQRSRAGL+DP+RPIASF+F+GPTGVGKTELAKALA++MF+TEEALVRIDMSEYMEKHAVSRLIGAPPGYVGY+EGGQLTE +RRRPYAV+LFDEIEKAH DVFNVFLQILDDGRVTDSQGRTV F NT+IIMTSN+GSQYIL++  +    ++ Y  +  RVM+A R  FRPEF+NRVDE+I+F  L +DQ+  IV+LQ+ R+Q+R++DR + + +T+ AI  L  +GYDP YGARP+KR IQ+ +E  +AK ILRG+F
Sbjct:  575 VVGQDEAVSAVAEAIQRSRAGLADPNRPIASFIFLGPTGVGKTELAKALAAFMFDTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYDEGGQLTEAIRRRPYAVVLFDEIEKAHPDVFNVFLQILDDGRVTDSQGRTVDFKNTIIIMTSNIGSQYILDVAGD----DSRYSEMYNRVMEAMRAHFRPEFLNRVDEFIIFHSLRKDQLRQIVQLQVQRLQQRLSDRHITLSLTEKAIDFLAEVGYDPVYGARPLKRAIQKQLETPIAKAILRGDF 844          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB2_ANASP (Chaperone protein clpB 2 OS=Anabaena sp. (strain PCC 7120) GN=clpB2 PE=3 SV=2)

HSP 1 Score: 386.726 bits (992), Expect = 1.451e-106
Identity = 187/274 (68.25%), Postives = 234/274 (85.40%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            V+GQD AV +VA+AIQRSRAGL+DP+RP ASF+F+GPTGVGKTELAKALASYMF+TE+ALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTE +RRRPYAVILFDEIEKAH DVFN+FLQILDDGRVTD+QG TV F NT+IIMTSN+GSQYIL++  +     + Y+ ++ RVM+A R  FRPEF+NR+DE I+F  LD+ ++  IV+LQ++R++ R+ DRK+ ++++D A+  L  +GYDP +GARP+KR IQ+ +E ++AK ILRGEF
Sbjct:  576 VIGQDEAVTAVADAIQRSRAGLADPNRPTASFVFLGPTGVGKTELAKALASYMFDTEDALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTETIRRRPYAVILFDEIEKAHPDVFNIFLQILDDGRVTDAQGHTVDFKNTIIIMTSNIGSQYILDIAGD----NSRYDEMRHRVMEAMRNSFRPEFLNRIDEVIIFHSLDKKELRQIVQLQVERLKARLDDRKISLRLSDVALDFLAEVGYDPVFGARPLKRAIQRELETQIAKAILRGEF 845          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB1_SYNE7 (Chaperone protein clpB 1 OS=Synechococcus elongatus (strain PCC 7942) GN=clpB1 PE=2 SV=3)

HSP 1 Score: 380.563 bits (976), Expect = 1.040e-104
Identity = 185/274 (67.52%), Postives = 233/274 (85.04%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            V+GQ+ AV +VA+AIQRSRAGLSDP RPIASF+F+GPTGVGKTELAKALA+Y+F+TE+A++RIDMSEYMEKHAVSRLIGAPPGYVGY+EGGQLTE VRRRPY+VILFDEIEKAH DVFNV LQILDDGRVTDS+GRTV F NT++I+TSN+GSQYIL++  +    ++ YE ++ RV +A R  FRPEF+NRVDE I+F  L +DQ+  IVR+QL R+++R++DRK+ + ++  AI  L  +G+DP YGARP+KRVIQ+ +E  +AK ILRG+F
Sbjct:  576 VIGQEEAVSAVADAIQRSRAGLSDPKRPIASFIFLGPTGVGKTELAKALAAYLFDTEDAMIRIDMSEYMEKHAVSRLIGAPPGYVGYDEGGQLTEAVRRRPYSVILFDEIEKAHPDVFNVMLQILDDGRVTDSRGRTVDFKNTILILTSNIGSQYILDVAGD----DSRYEEMRSRVTEALRANFRPEFLNRVDETIIFHSLRKDQLQQIVRIQLHRLEERLSDRKLSLSMSPEAIDFLVEIGFDPVYGARPLKRVIQRELETAIAKAILRGQF 845          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB2_SYNY3 (Chaperone protein clpB 2 OS=Synechocystis sp. (strain PCC 6803) GN=clpB2 PE=3 SV=1)

HSP 1 Score: 377.096 bits (967), Expect = 1.150e-103
Identity = 183/275 (66.55%), Postives = 230/275 (83.64%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEFK 885
            V+GQD AV +VAEAIQRSRAGLSDP+RP ASF+F+GPTGVGKTELAKALA  +F+TEEALVRIDMSEYMEKHAVSRL+GAPPGYVGYEEGGQLTE +RRRPY+VILFDEIEKAH DVFNV LQILDDGR+TD+QG  V F NT+IIMTSN+GSQYIL++  +    ++ YE ++ RVMD  R  FRPEF+NRVDE I+F  L + ++ SIV++Q+  +  R+ ++K+ +++TD A+  L ++GYDP YGARP+KR +Q+Y+E  +AKGILRG++K
Sbjct:  576 VIGQDEAVTAVAEAIQRSRAGLSDPNRPTASFIFLGPTGVGKTELAKALAKNLFDTEEALVRIDMSEYMEKHAVSRLMGAPPGYVGYEEGGQLTEAIRRRPYSVILFDEIEKAHGDVFNVMLQILDDGRLTDAQGHVVDFKNTIIIMTSNLGSQYILDVAGD----DSRYEEMRSRVMDVMRENFRPEFLNRVDETIIFHGLQKSELRSIVQIQIQSLATRLEEQKLTLKLTDKALDFLAAVGYDPVYGARPLKRAVQKYLETAIAKGILRGDYK 846          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_GLOVI (Chaperone protein clpB OS=Gloeobacter violaceus GN=clpB PE=3 SV=1)

HSP 1 Score: 372.474 bits (955), Expect = 2.832e-102
Identity = 181/274 (66.06%), Postives = 232/274 (84.67%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            VVGQ+ AV+ V+EAIQRSRAGL+DP+RPIASF+F+GPTGVGKTELAKALAS++F+ E A+VRIDMSEYMEKH+VSRLIGAPPGYVGY+EGGQLTE VRRRPYAV+LFDEIEKAH+DVFNV LQ+LDDGR+TDSQGRT+ F N VIIMTSN+GS  IL +       +  YE +++ VM A ++ FRPEF+NRVD+ I+F+ L RDQ+++IV+LQ+ R++KR+ADRK+ +++++AAI  +   GYDP YGARP+KR IQ  + N LA+G+L+G+F
Sbjct:  577 VVGQEEAVRIVSEAIQRSRAGLADPNRPIASFIFLGPTGVGKTELAKALASFLFDDENAMVRIDMSEYMEKHSVSRLIGAPPGYVGYDEGGQLTEAVRRRPYAVVLFDEIEKAHNDVFNVLLQVLDDGRITDSQGRTIDFKNAVIIMTSNIGSDAILRLGG----NDAYYEQMREEVMRAMQVHFRPEFLNRVDDIIIFRNLRRDQLAAIVKLQIARLEKRLADRKITLKLSEAAIDYIVEAGYDPVYGARPLKRAIQNELVNPLARGLLKGDF 846          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_PROMM (Chaperone protein clpB OS=Prochlorococcus marinus (strain MIT 9313) GN=clpB PE=3 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 7.713e-100
Identity = 183/292 (62.67%), Postives = 230/292 (78.77%), Query Frame = 1
Query:    1 KLQQSXXXXXXXXXXXXXXXVVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRG 876
            KL QS               V+GQ+ AV++VA+AIQRSRAGLSDP+RPIASF+F+GPTGVGKTEL+KALAS +F++E ALVRIDMSEYMEKH+VSRLIGAPPGYVGYE GGQLTE VRRRPYAVILFDE+EKAH DVFNV LQILDDGRVTD QGRTV FTNTV+I+TSN+GSQ IL++  +    ++ Y  +++RV DA    FRPEF+NR+DE I+F  L R+++  IV LQ++R+++R+ DRK+ ++++D A   L + GYDP YGARP+KR IQ+ +E  +AK IL G
Sbjct:  556 KLVQSEMEKLLGLEAELHQRVIGQEQAVQAVADAIQRSRAGLSDPNRPIASFLFLGPTGVGKTELSKALASQLFDSEAALVRIDMSEYMEKHSVSRLIGAPPGYVGYEAGGQLTEAVRRRPYAVILFDEVEKAHQDVFNVMLQILDDGRVTDGQGRTVDFTNTVLILTSNIGSQSILDLGGD----DSQYREMERRVHDALHAHFRPEFLNRLDETIIFHSLRREELRQIVALQVNRLRERLCDRKLGLEISDTAADWLANAGYDPVYGARPLKRAIQRELETPIAKSILAG 843          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_PLEBO (Chaperone protein clpB OS=Plectonema boryanum GN=clpB PE=2 SV=2)

HSP 1 Score: 362.459 bits (929), Expect = 2.931e-99
Identity = 184/274 (67.15%), Postives = 223/274 (81.39%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            V+GQD AV +V++AIQRSRAGLSDP+RP ASF+F+GPTGVGKTELAKALA+++F+TEEA+VRIDMSEYMEKH+VSRLIGAPPGYVGYEEGGQLTE VRRRPY+VILFDEIEKAH DVFNV LQILDDGRVTDSQGRTV F NT+IIMTSN+GSQYI     +    +  YE I  RVM+A    FRPEF+NR+DE I+F  L + Q+  IV++Q  R++ R+A RKM ++++DAA+  L   G+DP YGARP+KR IQ+ +E  +AK ILR  F
Sbjct:  577 VIGQDEAVTAVSDAIQRSRAGLSDPNRPTASFIFLGPTGVGKTELAKALAAFLFDTEEAMVRIDMSEYMEKHSVSRLIGAPPGYVGYEEGGQLTEAVRRRPYSVILFDEIEKAHPDVFNVMLQILDDGRVTDSQGRTVDFKNTIIIMTSNIGSQYIFEYGGD----DDRYEEILSRVMEAMLSNFRPEFLNRIDEIIIFHSLQKAQLREIVKIQTHRLESRLA-RKMSLKLSDAALDFLAE-GFDPVYGARPLKRAIQRELETTIAKEILRSNF 844          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB1_ANASP (Chaperone protein clpB 1 OS=Anabaena sp. (strain PCC 7120) GN=clpB1 PE=3 SV=1)

HSP 1 Score: 355.14 bits (910), Expect = 4.679e-97
Identity = 169/274 (61.68%), Postives = 221/274 (80.66%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGEF 882
            V+GQ  AV++V+ AI+R+RAG+ DP+RPI SF+FMGPTGVGKTELA+ALA ++F+ ++ALVR+DMSEYMEKH+VSRL+GAPPGYVGYEEGGQL+E VRR PY+V+L DE+EKAH DVFN+ LQ+LDDGR+TDSQGRTV F NTVI+MTSN+GS++IL++  +    +T YET++ RVMDA R  FRPEF+NRVD+ I+F  L R ++S I+R+QL RV+  + D+K+  +++ AA   L   GYDP YGARP+KR IQ+ +EN LA  IL   F
Sbjct:  579 VIGQQEAVEAVSAAIRRARAGMKDPNRPIGSFLFMGPTGVGKTELARALAQFLFDADDALVRLDMSEYMEKHSVSRLVGAPPGYVGYEEGGQLSEAVRRHPYSVVLLDEVEKAHPDVFNILLQVLDDGRITDSQGRTVDFRNTVIVMTSNIGSEHILDVSGD----DTQYETMRNRVMDALRSHFRPEFLNRVDDTILFHALSRSEMSHIIRIQLKRVESLLRDQKISFEISPAACDFLVEKGYDPVYGARPLKRAIQREIENPLATKILENTF 848          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB_MEIRU (Chaperone protein clpB OS=Meiothermus ruber GN=clpB PE=3 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 7.981e-97
Identity = 174/273 (63.74%), Postives = 222/273 (81.32%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            VVGQD A+ +VA+AI+R+RAGL DP+RPI SF+F+GPTGVGKTELAK LA+ +F+TEE +VRIDMSEY EKH V+RLIGAPPGYVGYEEGGQLTE VRRRPY+VILFDEIEKAH DVFNV LQ+LDDGR+TD QGRTV F NTVII+TSN+GS  I     E      +YETI++RV    +  FRPEF+NR+DE +VF+PL R+QI++IV++QL+ V+KR+A+R++ ++++  A+  L   GYDP +GARP+KRVIQ+ +E  L++ IL GE
Sbjct:  560 VVGQDEAIVAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAASLFDTEENMVRIDMSEYQEKHTVARLIGAPPGYVGYEEGGQLTEAVRRRPYSVILFDEIEKAHPDVFNVLLQVLDDGRLTDGQGRTVDFRNTVIILTSNIGSPLIF----EGIQSGQSYETIRERVFGVLQQHFRPEFLNRLDEIVVFRPLAREQIAAIVQIQLEAVRKRLAERRITLELSQEALDFLAQRGYDPVFGARPLKRVIQRELETPLSRKILAGE 828          
BLAST of DC900342 vs. ExPASy Swiss-Prot
Match: CLPB1_SYNPX (Chaperone protein clpB 1 OS=Synechococcus sp. (strain WH8102) GN=clpB1 PE=3 SV=2)

HSP 1 Score: 354.369 bits (908), Expect = 7.981e-97
Identity = 173/273 (63.37%), Postives = 228/273 (83.52%), Query Frame = 1
Query:   61 VVGQDPAVKSVAEAIQRSRAGLSDPHRPIASFMFMGPTGVGKTELAKALASYMFNTEEALVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEVVRRRPYAVILFDEIEKAHSDVFNVFLQILDDGRVTDSQGRTVSFTNTVIIMTSNVGSQYILNMDDETFPKETAYETIKQRVMDAARLIFRPEFMNRVDEYIVFQPLDRDQISSIVRLQLDRVQKRIADRKMKMQVTDAAIQLLGSLGYDPNYGARPVKRVIQQYVENELAKGILRGE 879
            V+GQ+ AV +VA+AIQRSRAGLSDP+RPIASF+F+GPTGVGKTEL+KALA+ +F++++A+VRIDMSEYMEKH VSRLIGAPPGYVGYE GGQLTE VRRRPYAVILFDE+EKAH DVFNV LQILDDGRVTD QGRTV FTNTV+I+TSN+GSQ IL +  +  P++  +  ++QRV +A +  FRPEF+NR+D+ I+F+ L+++++  IV LQ++R++ R+  RK+ +Q++D A   L ++G+DP YGARP+KR IQ+ +E  +AK IL G+
Sbjct:  575 VIGQNQAVTAVADAIQRSRAGLSDPNRPIASFLFLGPTGVGKTELSKALANRLFDSDDAMVRIDMSEYMEKHTVSRLIGAPPGYVGYEAGGQLTEAVRRRPYAVILFDEVEKAHPDVFNVMLQILDDGRVTDGQGRTVDFTNTVLILTSNIGSQSILELAGD--PEQ--HTAMEQRVNEALKAKFRPEFLNRLDDQIIFRSLEKEELRRIVSLQVERLRSRLEQRKLDLQLSDIAADWLATIGFDPVYGARPLKRAIQRELETPIAKAILAGQ 843          
The following BLAST results are available for this feature:
BLAST of DC900342 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 200
Match NameE-valueIdentityDescription
CLPB1_THEEB3.454e-10870.44Chaperone protein clpB 1 OS=Thermosynechococcus el... [more]
CLPB2_ANASP1.451e-10668.25Chaperone protein clpB 2 OS=Anabaena sp. (strain P... [more]
CLPB1_SYNE71.040e-10467.52Chaperone protein clpB 1 OS=Synechococcus elongatu... [more]
CLPB2_SYNY31.150e-10366.55Chaperone protein clpB 2 OS=Synechocystis sp. (str... [more]
CLPB_GLOVI2.832e-10266.06Chaperone protein clpB OS=Gloeobacter violaceus GN... [more]
CLPB_PROMM7.713e-10062.67Chaperone protein clpB OS=Prochlorococcus marinus ... [more]
CLPB_PLEBO2.931e-9967.15Chaperone protein clpB OS=Plectonema boryanum GN=c... [more]
CLPB1_ANASP4.679e-9761.68Chaperone protein clpB 1 OS=Anabaena sp. (strain P... [more]
CLPB_MEIRU7.981e-9763.74Chaperone protein clpB OS=Meiothermus ruber GN=clp... [more]
CLPB1_SYNPX7.981e-9763.37Chaperone protein clpB 1 OS=Synechococcus sp. (str... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900342 VSS Citrus sinensis cDNA clone VS28693 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900342 ID=DC900342|Name=DC900342|organism=Citrus sinensis|type=EST|length=1211bp
AAGCTTCAACAATCAGAGAGGGAGAAGCTGTTACATTTGGAGGAAGAGCT
GCACAAACGTGTTGTGGGTCAAGATCCAGCAGTGAAATCAGTAGCTGAGG
CGATTCAGCGATCTCGAGCAGGTCTTTCTGATCCTCACCGTCCAATAGCT
AGTTTCATGTTCATGGGTCCAACTGGTGTTGGAAAGACTGAACTGGCTAA
GGCACTAGCTTCCTACATGTTCAACACTGAAGAGGCCCTTGTACGAATTG
ATATGAGTGAGTATATGGAAAAGCATGCTGTTTCAAGATTGATTGGAGCC
CCACCTGGTTATGTGGGATATGAGGAAGGAGGACAGTTGACGGAGGTAGT
TCGCCGTAGGCCCTATGCAGTAATTCTGTTCGACGAGATTGAGAAGGCCC
ACTCTGATGTATTTAATGTGTTTCTTCAAATTCTGGATGATGGGAGAGTT
ACTGATTCACAGGGTCGTACTGTGAGTTTCACCAATACTGTCATCATTAT
GACTTCAAACGTGGGTTCACAATACATACTTAATATGGATGATGAGACAT
TCCCGAAGGAGACAGCCTATGAAACTATCAAACAGCGGGTAATGGATGCT
GCAAGATTAATATTCCGCCCCGAGTTCATGAACCGAGTAGATGAGTATAT
AGTATTCCAACCACTGGACCGTGACCAGATAAGCAGTATTGTGAGGTTAC
AGTTGGATCGGGTGCAGAAGAGGATTGCAGACCGGAAGATGAAAATGCAA
GTGACCGATGCAGCTATTCAGCTCCTTGGGAGTCTTGGGTATGACCCCAA
CTATGGTGCAAGGCCGGTCAAGAGGGTGATTCAGCAGTACGTTGAAAATG
AGCTTGCCAAGGGCATTCTGAGAGGGGAGTTCAAGGATGATGACACAATT
GTAACAGACACTGAAGTTACAGCATTTTCCAATGGCCAGCTTCCGCAGCA
AAAGCTAGTCTTCAGGAGACTTGATACCAGTTCGGATGCTTCTGCTGCAG
ATAACCAAGAAGCTTTCTCACAGACAGCATAAATGTCTGTCCAATGTGTT
TAATTTTACGAAATTATATTTGTGTTCAGCAAAATTATGAGCGAATTTTC
TTAACTGATAGGCTGTAACCTGCTTCTTGTATATGATGATGCTTTATACA
AAATCATAAGCCTTGAAGTGTTTCTTTTTCAACGATCATCACAAATTCAC
ATTCGTTTTAT
back to top