DC900271

Overview
NameDC900271
Unique NameDC900271
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length828
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11078 contig Csv1_Contig11078:526..1354. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900271 vs. ExPASy Swiss-Prot
Match: RHDF1_DANRE (Rhomboid family member 1 OS=Danio rerio GN=rhbdf1 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 4.101e-13
Identity = 55/212 (25.94%), Postives = 86/212 (40.57%), Query Frame = 2
Query:    8 QGWRLITCIWLHAGIIHLLVNMLCLVFIGIRLEQQFGFVRIGVIYLLSGFGGSVLSCLFIRNSIXXXXXXXXXXXXXXXXXELLTNWSLYTNKXXXXXXXXXXXXXXXXXXXXPHVDNFAHIXXXXXXXXXXXXXXPRPRYGWLDGRNLPGSAAIKSKYKTHQYVLWLVSLVLLIAGLTVALVMLFRGENGNDRCRWCHYMSCVPTSSWNCE 643
            Q +RL   ++LHAGI+H LV++   + I   LE+  G++RI +IY+LSG  G++ S +F+                     EL+ +W +                        P +DNFAHI              P   +G LD              K  Q +++LV  + L AGL V   +         +C WC  ++C+P +   CE
Sbjct:  654 QFYRLWLSLFLHAGILHCLVSVCFQMTILRDLEKLAGWLRISIIYILSGITGNLASAIFLPYRAEVGPAGSQFGILACLFVELIQSWQILAQPWRAFTKLLCVVLFLFAFGLLPWIDNFAHISGFISGFFLSFAFLPYISFGRLD-----------MYRKRCQIIIFLVVFLGLFAGLVVLFYV------HPIKCEWCELLTCIPFTDKFCE 848          
BLAST of DC900271 vs. ExPASy Swiss-Prot
Match: RHDF1_MOUSE (Rhomboid family member 1 OS=Mus musculus GN=Rhbdf1 PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 2.658e-12
Identity = 54/212 (25.47%), Postives = 83/212 (39.15%), Query Frame = 2
Query:    8 QGWRLITCIWLHAGIIHLLVNMLCLVFIGIRLEQQFGFVRIGVIYLLSGFGGSVLSCLFIRNSIXXXXXXXXXXXXXXXXXELLTNWSLYTNKXXXXXXXXXXXXXXXXXXXXPHVDNFAHIXXXXXXXXXXXXXXPRPRYGWLDGRNLPGSAAIKSKYKTHQYVLWLVSLVLLIAGLTVALVMLFRGENGNDRCRWCHYMSCVPTSSWNCE 643
            Q +RL   ++LHAGI+H LV++   + +   LE+  G+ RI +IYLLSG  G++ S +F+                     EL  +W +                        P +DNFAHI              P   +G  D              K  Q +++ V  + L+AGL V             RC WC +++C+P +   CE
Sbjct:  653 QFYRLWLSLFLHAGILHCLVSVCFQMTVLRDLEKLAGWHRIAIIYLLSGITGNLASAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLFAFGLLPWIDNFAHISGFVSGLFLSFAFLPYISFGKFD-----------LYRKRCQIIIFQVVFLGLLAGLVVLFYFY------PVRCEWCEFLTCIPFTDKFCE 847          
BLAST of DC900271 vs. ExPASy Swiss-Prot
Match: RHDF1_HUMAN (Rhomboid family member 1 OS=Homo sapiens GN=RHBDF1 PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 2.658e-12
Identity = 54/212 (25.47%), Postives = 84/212 (39.62%), Query Frame = 2
Query:    8 QGWRLITCIWLHAGIIHLLVNMLCLVFIGIRLEQQFGFVRIGVIYLLSGFGGSVLSCLFIRNSIXXXXXXXXXXXXXXXXXELLTNWSLYTNKXXXXXXXXXXXXXXXXXXXXPHVDNFAHIXXXXXXXXXXXXXXPRPRYGWLDGRNLPGSAAIKSKYKTHQYVLWLVSLVLLIAGLTVALVMLFRGENGNDRCRWCHYMSCVPTSSWNCE 643
            Q +RL   ++LHAGI+H LV++   + +   LE+  G+ RI +IYLLSG  G++ S +F+                     EL  +W +                        P +DNFAHI              P   +G  D              K  Q +++ V  + L+AGL V   +         RC WC +++C+P +   CE
Sbjct:  652 QFYRLWLSLFLHAGILHCLVSICFQMTVLRDLEKLAGWHRIAIIYLLSGVTGNLASAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLFTFGLLPWIDNFAHISGFISGLFLSFAFLPYISFGKFD-----------LYRKRCQIIIFQVVFLGLLAGLVVLFYVY------PVRCEWCEFLTCIPFTDKFCE 846          
BLAST of DC900271 vs. ExPASy Swiss-Prot
Match: RHDF1_PAPAN (Rhomboid family member 1 OS=Papio anubis GN=RHBDF1 PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.472e-12
Identity = 54/212 (25.47%), Postives = 83/212 (39.15%), Query Frame = 2
Query:    8 QGWRLITCIWLHAGIIHLLVNMLCLVFIGIRLEQQFGFVRIGVIYLLSGFGGSVLSCLFIRNSIXXXXXXXXXXXXXXXXXELLTNWSLYTNKXXXXXXXXXXXXXXXXXXXXPHVDNFAHIXXXXXXXXXXXXXXPRPRYGWLDGRNLPGSAAIKSKYKTHQYVLWLVSLVLLIAGLTVALVMLFRGENGNDRCRWCHYMSCVPTSSWNCE 643
            Q +RL   ++LHAGI+H LV++   + +   LE+  G+ RI +IYLLSG  G++ S +F+                     EL  +W +                        P +DNFAHI              P   +G  D              K  Q +++ V  + L+AGL V             RC WC +++C+P +   CE
Sbjct:  652 QFYRLWLSLFLHAGILHCLVSICFQMTVLRDLEKLAGWHRIAIIYLLSGVTGNLASAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLFTFGLLPWIDNFAHISGFISGLFLSFAFLPYISFGKFD-----------LYRKRCQIIIFQVVFLGLLAGLVVLFYFY------PVRCEWCEFLTCIPFTDKFCE 846          
BLAST of DC900271 vs. ExPASy Swiss-Prot
Match: RHDF1_CALJA (Rhomboid family member 1 OS=Callithrix jacchus GN=RHBDF1 PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.472e-12
Identity = 54/212 (25.47%), Postives = 84/212 (39.62%), Query Frame = 2
Query:    8 QGWRLITCIWLHAGIIHLLVNMLCLVFIGIRLEQQFGFVRIGVIYLLSGFGGSVLSCLFIRNSIXXXXXXXXXXXXXXXXXELLTNWSLYTNKXXXXXXXXXXXXXXXXXXXXPHVDNFAHIXXXXXXXXXXXXXXPRPRYGWLDGRNLPGSAAIKSKYKTHQYVLWLVSLVLLIAGLTVALVMLFRGENGNDRCRWCHYMSCVPTSSWNCE 643
            Q +RL   ++LHAGI+H LV++   + +   LE+  G+ RI +IYLLSG  G++ S +F+                     EL  +W +                        P +DNFAHI              P   +G  D              K  Q +++ V  + L+AGL V   +         RC WC +++C+P +   CE
Sbjct:  652 QFYRLWLSLFLHAGILHCLVSICFQMTVLRDLEKLAGWHRIAIIYLLSGVTGNLASAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLFTFGLLPWIDNFAHISGFISGLFLSFAFLPYISFGKFD-----------LYRKRCQIIVFQVVFLGLLAGLVVLFYVY------PVRCEWCEFLTCIPFTDKFCE 846          
BLAST of DC900271 vs. ExPASy Swiss-Prot
Match: RHDF1_BOVIN (Rhomboid family member 1 OS=Bos taurus GN=RHBDF1 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.472e-12
Identity = 52/212 (24.53%), Postives = 84/212 (39.62%), Query Frame = 2
Query:    8 QGWRLITCIWLHAGIIHLLVNMLCLVFIGIRLEQQFGFVRIGVIYLLSGFGGSVLSCLFIRNSIXXXXXXXXXXXXXXXXXELLTNWSLYTNKXXXXXXXXXXXXXXXXXXXXPHVDNFAHIXXXXXXXXXXXXXXPRPRYGWLDGRNLPGSAAIKSKYKTHQYVLWLVSLVLLIAGLTVALVMLFRGENGNDRCRWCHYMSCVPTSSWNCE 643
            Q +RL   ++LHAG++H LV++   + +   LE+  G+ RI +IYLLSG  G++ S +F+                     EL  +W +                        P +DNFAHI              P   +G               K+  ++    ++   L+  GL   LV+LF       RC WC +++C+P +   CE
Sbjct:  653 QFYRLWLSLFLHAGVLHCLVSVCFQMTVLRDLEKLAGWHRIAIIYLLSGVTGNLASAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLFTFGLLPWIDNFAHISGFISGLFLSFAFLPYISFG---------------KFDLYRKRCQIIVFQLVFLGLLAGLVVLFYFY--PVRCEWCEFLTCIPFTDKFCE 847          
BLAST of DC900271 vs. ExPASy Swiss-Prot
Match: RHDF1_CALMO (Rhomboid family member 1 OS=Callicebus moloch GN=RHBDF1 PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 4.534e-12
Identity = 54/212 (25.47%), Postives = 83/212 (39.15%), Query Frame = 2
Query:    8 QGWRLITCIWLHAGIIHLLVNMLCLVFIGIRLEQQFGFVRIGVIYLLSGFGGSVLSCLFIRNSIXXXXXXXXXXXXXXXXXELLTNWSLYTNKXXXXXXXXXXXXXXXXXXXXPHVDNFAHIXXXXXXXXXXXXXXPRPRYGWLDGRNLPGSAAIKSKYKTHQYVLWLVSLVLLIAGLTVALVMLFRGENGNDRCRWCHYMSCVPTSSWNCE 643
            Q +RL   ++LHAGI+H LV++   + +   LE+  G+ RI +IYLLSG  G++ S +F+                     EL  +W +                        P +DNFAHI              P   +G  D              K  Q +++ V  + L+AGL V             RC WC +++C+P +   CE
Sbjct:  652 QFYRLWLSLFLHAGILHCLVSICFQMTVLRDLEKLAGWHRIAIIYLLSGVTGNLASAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLFTFGLLPWIDNFAHISGFISGLFLSFAFLPYISFGKFD-----------LYRKRCQIIVFQVVFLGLLAGLVVLFYFY------PVRCEWCEFLTCIPFTDKFCE 846          
BLAST of DC900271 vs. ExPASy Swiss-Prot
Match: RHDF1_RAT (Rhomboid family member 1 OS=Rattus norvegicus GN=Rhbdf1 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.010e-11
Identity = 53/212 (25.00%), Postives = 82/212 (38.68%), Query Frame = 2
Query:    8 QGWRLITCIWLHAGIIHLLVNMLCLVFIGIRLEQQFGFVRIGVIYLLSGFGGSVLSCLFIRNSIXXXXXXXXXXXXXXXXXELLTNWSLYTNKXXXXXXXXXXXXXXXXXXXXPHVDNFAHIXXXXXXXXXXXXXXPRPRYGWLDGRNLPGSAAIKSKYKTHQYVLWLVSLVLLIAGLTVALVMLFRGENGNDRCRWCHYMSCVPTSSWNCE 643
            Q +RL   ++LHAGI+H LV++   + +   LE+  G+ RI +IYLLSG  G++ S +F+                     EL  +W +                        P +DNFAHI              P   +G  D              K  Q +++    + L+AGL V             RC WC +++C+P +   CE
Sbjct:  653 QFYRLWLSLFLHAGILHCLVSVCFQMTVLRDLEKLAGWHRIAIIYLLSGVTGNLASAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLFAFGLLPWIDNFAHISGFVSGLFLSFAFLPYISFGKFD-----------LYRKRCQIIIFQAVFLGLLAGLVVLFYFY------PVRCEWCEFLTCIPFTDKFCE 847          
The following BLAST results are available for this feature:
BLAST of DC900271 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
RHDF1_DANRE4.101e-1325.94Rhomboid family member 1 OS=Danio rerio GN=rhbdf1 ... [more]
RHDF1_MOUSE2.658e-1225.47Rhomboid family member 1 OS=Mus musculus GN=Rhbdf1... [more]
RHDF1_HUMAN2.658e-1225.47Rhomboid family member 1 OS=Homo sapiens GN=RHBDF1... [more]
RHDF1_PAPAN3.472e-1225.47Rhomboid family member 1 OS=Papio anubis GN=RHBDF1... [more]
RHDF1_CALJA3.472e-1225.47Rhomboid family member 1 OS=Callithrix jacchus GN=... [more]
RHDF1_BOVIN3.472e-1224.53Rhomboid family member 1 OS=Bos taurus GN=RHBDF1 P... [more]
RHDF1_CALMO4.534e-1225.47Rhomboid family member 1 OS=Callicebus moloch GN=R... [more]
RHDF1_RAT1.010e-1125.00Rhomboid family member 1 OS=Rattus norvegicus GN=R... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900271 VSS Citrus sinensis cDNA clone VS28616 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900271 ID=DC900271|Name=DC900271|organism=Citrus sinensis|type=EST|length=828bp
AAAACATCAAGGATGGAGGCTTATCACTTGTATCTGGTTGCACGCCGGTA
TTATTCATCTCCTCGTAAACATGCTATGCCTGGTTTTCATTGGTATTCGC
CTTGAACAGCAATTTGGGTTCGTGCGGATTGGAGTTATTTACCTGTTATC
TGGATTCGGTGGGAGTGTTCTTTCCTGCCTATTTATTCGAAACAGCATCT
CTGTTGGTGCCTCCGGTGCACTTTTTGGGCTTCTGGGAGCAATGCTTTCA
GAACTACTTACTAACTGGAGTCTTTATACCAACAAGGCTGCAGCCTTGAT
TACTCTTTTGGTCATCATTGCAATTAATCTCGCTATAGGAATTCTGCCGC
ATGTTGATAATTTCGCTCACATTGGTGGATTTCTCACTGGGTTCTTCCTT
GGTTTTGTCTTGTTGCCCCGTCCTCGGTACGGATGGCTTGATGGCAGGAA
CCTTCCTGGAAGTGCCGCCATAAAATCCAAGTATAAGACACATCAATACG
TGTTATGGCTGGTCTCTCTGGTTCTACTAATTGCAGGATTAACAGTTGCA
CTGGTGATGCTCTTCCGGGGAGAGAATGGTAATGATCGTTGCAGATGGTG
TCACTACATGAGCTGCGTTCCCACCTCCAGTTGGAATTGCGAAGGAAATG
TGTAGATTGCAATTGCTAGCTCTACGTTCACATGTAAATGCATGCATAGT
TATAGCTTAGAAGCTGGATTTCTTCATGCTTGATTCTTTATCATGATTTT
AAACTCGGGAGACCACCTTTGTAGTTGCTTTTACTTTCGGCGTTTTGCCA
TCGTAATAGAATTATTGCGTGTATACTT
back to top