DC900242

Overview
NameDC900242
Unique NameDC900242
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length384
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13843 contig Csv1_Contig13843:79..462. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900242 vs. ExPASy Swiss-Prot
Match: Y2309_ARATH (Uncharacterized protein At2g23090 OS=Arabidopsis thaliana GN=At2g23090 PE=1 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 3.705e-34
Identity = 65/78 (83.33%), Postives = 72/78 (92.31%), Query Frame = 1
Query:    7 MGGGNGQKSKMAREKNMEKQRAAGKGSQLESNKKAMSIQCKVCMQTFICTTSEVKCKEHAEARHPKSDLFTCFPHLKK 240
            MGGGN QKS MAR KN+EK +AAGKGSQLE+NKKAMSIQCKVCMQTFICTTSEVKC+EHAEA+HPK+D+  CFPHLKK
Sbjct:    1 MGGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHAEAKHPKADVVACFPHLKK 78          
The following BLAST results are available for this feature:
BLAST of DC900242 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y2309_ARATH3.705e-3483.33Uncharacterized protein At2g23090 OS=Arabidopsis t... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900242 VSS Citrus sinensis cDNA clone VS28282 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900242 ID=DC900242|Name=DC900242|organism=Citrus sinensis|type=EST|length=384bp
AAGGAAATGGGAGGCGGCAACGGCCAGAAATCAAAGATGGCTCGTGAGAA
GAACATGGAGAAGCAGAGAGCAGCTGGCAAGGGGAGTCAGCTGGAGTCAA
ACAAGAAAGCCATGTCCATCCAGTGCAAGGTATGCATGCAGACGTTCATT
TGCACCACATCTGAGGTGAAGTGCAAGGAACATGCCGAAGCCAGACACCC
CAAATCTGATTTATTTACATGTTTCCCTCATTTAAAGAAATGAAAAACCA
ATAATTTGATTATGTATTTGGAGATGGGTTTAAAGCCCTCGTCAGTATGT
GTCTTGCTGTGGGTTAAAATTAGAAAGCTTTTGGGAGAAAGAGGAATCCT
TCCAGTCTTATCAATACTAATAATTAACTATTTG
back to top