CN186110

Overview
NameCN186110
Unique NameCN186110
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length839
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN186110_ssr290 microsatellite CN186110_ssr290:290..304. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2521 contig Csv1_Contig2521:41..879. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN186110 vs. ExPASy Swiss-Prot
Match: RS17_DESAP (30S ribosomal protein S17 OS=Desulforudis audaxviator (strain MP104C) GN=rpsQ PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 7.153e-21
Identity = 46/75 (61.33%), Postives = 61/75 (81.33%), Query Frame = -1
Query:  330 GLVVSNKMQKSVVVAVDRLFHHKVYNRYVKRTSKFMAHDENNQCNIGDRVRLDPSRPLSKHKHWAVAEILKKARI 554
            G VVS+KM K+VVVAVD L  H +Y R V+RT KFMAHDE+NQC IGD+V++  +RPLS+HK W VAE+L++++I
Sbjct:   11 GRVVSDKMDKTVVVAVDTLVKHPLYGRTVRRTRKFMAHDEDNQCRIGDKVKIAETRPLSRHKRWRVAEVLERSQI 85          
BLAST of CN186110 vs. ExPASy Swiss-Prot
Match: RS17_THETN (30S ribosomal protein S17 OS=Thermoanaerobacter tengcongensis GN=rpsQ PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.033e-19
Identity = 44/79 (55.70%), Postives = 58/79 (73.42%), Query Frame = -1
Query:  336 QMKSVVGLVVSNKMQKSVVVAVDRLFHHKVYNRYVKRTSKFMAHDENNQCNIGDRVRLDPSRPLSKHKHWAVAEILKKA 572
            Q K  +G VVSNKMQK++VVAV+  F H +Y + VKRT K+  HDENN CN+GD V++  +RPLSK K W + E++KKA
Sbjct:    5 QRKVRIGTVVSNKMQKTIVVAVEDKFRHPLYGKIVKRTKKYKVHDENNICNVGDVVKIMETRPLSKEKRWRLVEVIKKA 83          
BLAST of CN186110 vs. ExPASy Swiss-Prot
Match: RS17_SYNS3 (30S ribosomal protein S17 OS=Synechococcus sp. (strain CC9311) GN=rpsQ PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.033e-19
Identity = 42/78 (53.85%), Postives = 60/78 (76.92%), Query Frame = -1
Query:  336 MKSVVGLVVSNKMQKSVVVAVDRLFHHKVYNRYVKRTSKFMAHDENNQCNIGDRVRLDPSRPLSKHKHWAVAEILKKA 569
            +K  VG VVS+KM K+VVVAV+  F H +Y + V RT+++ AHDE+N C +GDRVR+  +RPLS+HK WA+AE+L ++
Sbjct:    3 LKERVGTVVSDKMDKTVVVAVENRFPHPIYQKTVSRTTRYKAHDEDNACRVGDRVRITETRPLSRHKRWAIAEVLSQS 80          
BLAST of CN186110 vs. ExPASy Swiss-Prot
Match: RS17_SYNPX (30S ribosomal protein S17 OS=Synechococcus sp. (strain WH8102) GN=rpsQ PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.301e-19
Identity = 41/75 (54.67%), Postives = 59/75 (78.67%), Query Frame = -1
Query:  345 MKSVVGLVVSNKMQKSVVVAVDRLFHHKVYNRYVKRTSKFMAHDENNQCNIGDRVRLDPSRPLSKHKHWAVAEIL 569
            +K  VG VVS+KM+K+VVVAV+  F H +Y + V RT+++ AHDE+N C +GDRVR+  +RP+S+HK WA+AE+L
Sbjct:    3 VKERVGTVVSDKMEKTVVVAVESRFPHPIYQKTVSRTTRYKAHDEDNSCRVGDRVRITETRPMSRHKRWAIAEVL 77          
BLAST of CN186110 vs. ExPASy Swiss-Prot
Match: RS17_PHOPR (30S ribosomal protein S17 OS=Photobacterium profundum GN=rpsQ PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.005e-19
Identity = 41/81 (50.62%), Postives = 60/81 (74.07%), Query Frame = -1
Query:  330 QMKSVVGLVVSNKMQKSVVVAVDRLFHHKVYNRYVKRTSKFMAHDENNQCNIGDRVRLDPSRPLSKHKHWAVAEILKKARI 572
            Q +  +G V+S+KM KS+VVA++R+  H +Y +Y+KRT+K  AHDENN+CN+GD V +   RPLSK K W +  I++KAR+
Sbjct:    4 QTRIQLGRVISSKMDKSIVVAIERMVKHPMYGKYIKRTTKLHAHDENNECNLGDTVEVRECRPLSKTKSWTLVRIVEKARV 84          
BLAST of CN186110 vs. ExPASy Swiss-Prot
Match: RS17_CALS8 (30S ribosomal protein S17 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903) GN=rpsQ PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.005e-19
Identity = 42/78 (53.85%), Postives = 61/78 (78.21%), Query Frame = -1
Query:  333 KSVVGLVVSNKMQKSVVVAVDRLFHHKVYNRYVKRTSKFMAHDENNQCNIGDRVRLDPSRPLSKHKHWAVAEILKKAR 566
            K+ +G+VVS+KM K+VVVAV+ L  H +Y + +KRT+KF AHDENN+C +GD+V +  +RPLSK K W V +IL++A+
Sbjct:    9 KTRIGVVVSDKMDKTVVVAVETLVQHPLYKKTIKRTTKFKAHDENNECRVGDKVLIMETRPLSKEKRWRVVQILERAK 86          
BLAST of CN186110 vs. ExPASy Swiss-Prot
Match: RS17_ANATD (30S ribosomal protein S17 OS=Anaerocellum thermophilum (strain DSM 6725 / Z-1320) GN=rpsQ PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.005e-19
Identity = 43/78 (55.13%), Postives = 61/78 (78.21%), Query Frame = -1
Query:  333 KSVVGLVVSNKMQKSVVVAVDRLFHHKVYNRYVKRTSKFMAHDENNQCNIGDRVRLDPSRPLSKHKHWAVAEILKKAR 566
            K+ VG+VVS+KM K+VVVAV+R   H +Y + +KRT+KF AHDENN+C +GD+V +  +RPLSK K W V +IL++A+
Sbjct:    9 KTRVGVVVSDKMDKTVVVAVERHVQHPLYKKTIKRTTKFKAHDENNECRVGDKVLIMETRPLSKEKRWRVVQILERAK 86          
BLAST of CN186110 vs. ExPASy Swiss-Prot
Match: RS17_SYNPW (30S ribosomal protein S17 OS=Synechococcus sp. (strain WH7803) GN=rpsQ PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.925e-19
Identity = 43/75 (57.33%), Postives = 57/75 (76.00%), Query Frame = -1
Query:  345 MKSVVGLVVSNKMQKSVVVAVDRLFHHKVYNRYVKRTSKFMAHDENNQCNIGDRVRLDPSRPLSKHKHWAVAEIL 569
            +K  VG VVS+KM K+VVVAV+  F H +Y + V RT+++ AHDENN   +GDRVR+  +RPLS+HK WAVAE+L
Sbjct:    3 LKERVGTVVSDKMDKTVVVAVENRFPHPIYQKTVSRTTRYKAHDENNSVRVGDRVRITETRPLSRHKRWAVAEVL 77          
BLAST of CN186110 vs. ExPASy Swiss-Prot
Match: RS17_DESOH (30S ribosomal protein S17 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=rpsQ PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.925e-19
Identity = 42/73 (57.53%), Postives = 57/73 (78.08%), Query Frame = -1
Query:  336 GLVVSNKMQKSVVVAVDRLFHHKVYNRYVKRTSKFMAHDENNQCNIGDRVRLDPSRPLSKHKHWAVAEILKKA 554
            G VVS+KM K+V+VAV+RL  H+ Y +YV+RT+KF AHDE NQC +GD+V +  SRPLS+ KHW V  +++KA
Sbjct:   12 GTVVSDKMDKTVIVAVERLVKHQEYKKYVRRTAKFAAHDEQNQCAVGDKVIITESRPLSRTKHWRVVNVVEKA 84          
BLAST of CN186110 vs. ExPASy Swiss-Prot
Match: RS17_SYNFM (30S ribosomal protein S17 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rpsQ PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 5.126e-19
Identity = 43/82 (52.44%), Postives = 59/82 (71.95%), Query Frame = -1
Query:  330 SQMKSVVGLVVSNKMQKSVVVAVDRLFHHKVYNRYVKRTSKFMAHDENNQCNIGDRVRLDPSRPLSKHKHWAVAEILKKARI 575
            S  K+ VG V+SNKM K+VVV V+RL HH  Y+++++R +KF AHD  N C +GDRV ++ SRP+SK K W V ++L KA I
Sbjct:    6 SGRKTRVGRVLSNKMDKTVVVVVERLIHHPQYHKFIRRQNKFKAHDAQNACRVGDRVIIEESRPISKDKRWVVVQVLDKAVI 87          
The following BLAST results are available for this feature:
BLAST of CN186110 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RS17_DESAP7.153e-2161.3330S ribosomal protein S17 OS=Desulforudis audaxvia... [more]
RS17_THETN1.033e-1955.7030S ribosomal protein S17 OS=Thermoanaerobacter te... [more]
RS17_SYNS31.033e-1953.8530S ribosomal protein S17 OS=Synechococcus sp. (st... [more]
RS17_SYNPX2.301e-1954.6730S ribosomal protein S17 OS=Synechococcus sp. (st... [more]
RS17_PHOPR3.005e-1950.6230S ribosomal protein S17 OS=Photobacterium profun... [more]
RS17_CALS83.005e-1953.8530S ribosomal protein S17 OS=Caldicellulosiruptor ... [more]
RS17_ANATD3.005e-1955.1330S ribosomal protein S17 OS=Anaerocellum thermoph... [more]
RS17_SYNPW3.925e-1957.3330S ribosomal protein S17 OS=Synechococcus sp. (st... [more]
RS17_DESOH3.925e-1957.5330S ribosomal protein S17 OS=Desulfococcus oleovor... [more]
RS17_SYNFM5.126e-1952.4430S ribosomal protein S17 OS=Syntrophobacter fumar... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002G05_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002G05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186110 ID=CN186110|Name=CN186110|organism=Citrus sinensis|type=EST|length=839bp
CAATTAGAGAATAATACCTCCATTTCATTTAGCATCAAACAATCAAAAGT
ACATCGGTCTAATTAAGCATAAAACAATCATAGGTACATCTGTCTAAAGG
TTGACAAAAATTCAACACAACTAGAAGCATAACTCATTCCAAAACGGCAA
CATTAAACCGACATGTTTTATTGCTACAAGCAATTCTTGGAAACTGCTAC
CTAGGTCCAAGTCTTCTCACTTTCTGTATGTCCCCGTAAAGCTTAACCTT
AAGATGATGAAACCAGTGCTTCAGTCTGGGTATTTGAAACAGCAGCAGCA
GCAGCATTATCCGCTGAGGGTGGTACATAGATACGTGCTTTCTTTAGAAT
TTCGGCAACAGCCCAATGCTTATGCTTGCTTAACGGTCTAGAAGGATCCA
ACCTAACTCGGTCACCGATGTTGCATTGATTGTTCTCGTCGTGGGCCATG
AATTTGGAGGTTCGTTTGACATACCGATTGTAAACCTTGTGGTGAAAGAG
TCTGTCAACGGCCACCACTACTGATTTTTGCATCTTGTTTGACACTACCA
ATCCCACCACCGACTTCATTTGTGACGGCCTGATTACTATGCTTCAACAG
TGATACTACAGTGACGGCAGATGCTGACGGAGGTCGACGGCGCACGACAA
TAACTTGTGGTGAGGCGGCGGCAGGGGTTCAGGGGGCGGTTAGTGTCTGA
GTTGAGTGAAATTGGATTTCGTTTATTGTTGCTTTAAACTCATCGACTGT
GTTTGTGACTAAGGTGAGAAACTTGAAGCTAAAAGGTTGGTACTTGCTAA
GATAGCTCTAGCGAACGGACCTACCGCCGTAGCTCACCG
back to top