DC900047

Overview
NameDC900047
Unique NameDC900047
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length565
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900047 vs. ExPASy Swiss-Prot
Match: COBL6_ARATH (COBRA-like protein 6 OS=Arabidopsis thaliana GN=COBL6 PE=2 SV=2)

HSP 1 Score: 104.76 bits (260), Expect = 3.102e-22
Identity = 47/61 (77.05%), Postives = 53/61 (86.89%), Query Frame = 3
Query:   27 GXSGNVQTEMLLHKDSGIFTFREGWGFPRRILFNGDECVMPLPDDYPRLPNNAHTAASSSA 209
            G  GNVQTE+LL KD G FTFREGW FPRRILFNGDECVMP PDD+PRLP +AH+++SSSA
Sbjct:  374 GKIGNVQTELLLKKDMGNFTFREGWAFPRRILFNGDECVMPSPDDFPRLPKSAHSSSSSSA 434          
BLAST of DC900047 vs. ExPASy Swiss-Prot
Match: COBL6_ORYSJ (COBRA-like protein 6 OS=Oryza sativa subsp. japonica GN=BC1L7 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.543e-16
Identity = 37/59 (62.71%), Postives = 45/59 (76.27%), Query Frame = 3
Query:   27 GXSGNVQTEMLLHKDSGIFTFREGWGFPRRILFNGDECVMPLPDDYPRLPNNAHTAASS 203
            G  GNVQ+E+L+ KD+  FTFR+GW FPR++ FNGDEC MP PD YP LPN A  AA+S
Sbjct:  376 GPHGNVQSEVLMRKDARTFTFRQGWAFPRKVYFNGDECQMPPPDSYPYLPNAAPPAAAS 434          
BLAST of DC900047 vs. ExPASy Swiss-Prot
Match: COBL4_ARATH (COBRA-like protein 4 OS=Arabidopsis thaliana GN=COBL4 PE=2 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 9.664e-16
Identity = 34/53 (64.15%), Postives = 43/53 (81.13%), Query Frame = 3
Query:   27 GXSGNVQTEMLLHKDSGIFTFREGWGFPRRILFNGDECVMPLPDDYPRLPNNA 185
            G SGNVQ+E+LL KD   FTF++GW FPR++ FNGDEC++P PD YP LPN+A
Sbjct:  359 GPSGNVQSEVLLQKDQKTFTFKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSA 411          
BLAST of DC900047 vs. ExPASy Swiss-Prot
Match: COBRA_ARATH (Protein COBRA OS=Arabidopsis thaliana GN=COB PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 6.264e-15
Identity = 35/54 (64.81%), Postives = 39/54 (72.22%), Query Frame = 3
Query:   18 SKPGXSGNVQTEMLLHKDSGIFTFREGWGFPRRILFNGDECVMPLPDDYPRLPN 179
            S+ G  GNVQ+E+L  KD   FTF +GW FPRRI FNGD CVMP PD YP LPN
Sbjct:  378 SEAGPLGNVQSEILFRKDQSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPFLPN 431          
BLAST of DC900047 vs. ExPASy Swiss-Prot
Match: COBL1_ARATH (COBRA-like protein 1 OS=Arabidopsis thaliana GN=COBL1 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 7.986e-15
Identity = 35/60 (58.33%), Postives = 42/60 (70.00%), Query Frame = 3
Query:   27 GXSGNVQTEMLLHKDSGIFTFREGWGFPRRILFNGDECVMPLPDDYPRLPN-NAHTAASS 203
            G  GNVQ+E+L  K++  FTF +GW FPRRI FNGD CVMP PD YP LPN  +H +  S
Sbjct:  376 GPFGNVQSELLFQKEASAFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNTGSHKSVGS 435          

HSP 2 Score: 20.7866 bits (42), Expect = 7.986e-15
Identity = 7/9 (77.78%), Postives = 9/9 (100.00%), Query Frame = 2
Query:    2 YNDMLLQAG 28
            YND+L+QAG
Sbjct:  368 YNDLLMQAG 376          
BLAST of DC900047 vs. ExPASy Swiss-Prot
Match: COBL5_ORYSJ (COBRA-like protein 5 OS=Oryza sativa subsp. japonica GN=BC1 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.069e-14
Identity = 34/53 (64.15%), Postives = 40/53 (75.47%), Query Frame = 3
Query:   27 GXSGNVQTEMLLHKDSGIFTFREGWGFPRRILFNGDECVMPLPDDYPRLPNNA 185
            G  GNVQ+E+L+ KD   FTF +GW FPR+I FNGDEC MP PD YP LPN+A
Sbjct:  393 GPFGNVQSEVLMRKDYNTFTFSQGWAFPRKIYFNGDECKMPPPDSYPYLPNSA 445          
BLAST of DC900047 vs. ExPASy Swiss-Prot
Match: COBL5_ORYSI (COBRA-like protein 5 OS=Oryza sativa subsp. indica GN=BC1 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.069e-14
Identity = 34/53 (64.15%), Postives = 40/53 (75.47%), Query Frame = 3
Query:   27 GXSGNVQTEMLLHKDSGIFTFREGWGFPRRILFNGDECVMPLPDDYPRLPNNA 185
            G  GNVQ+E+L+ KD   FTF +GW FPR+I FNGDEC MP PD YP LPN+A
Sbjct:  393 GPFGNVQSEVLMRKDYNTFTFSQGWAFPRKIYFNGDECKMPPPDSYPYLPNSA 445          
BLAST of DC900047 vs. ExPASy Swiss-Prot
Match: COBL2_ARATH (COBRA-like protein 2 OS=Arabidopsis thaliana GN=COBL2 PE=1 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 3.109e-14
Identity = 36/62 (58.06%), Postives = 43/62 (69.35%), Query Frame = 3
Query:   18 SKPGXSGNVQTEMLLHKDSGIFTFREGWGFPRRILFNGDECVMPLPDDYPRLPNNAHTAASS 203
            S+ G  GNVQ+E+L  K+   FTF +GW FPRRI FNGD CVMP PD YP LPN +   A+S
Sbjct:  364 SQAGPVGNVQSELLFQKNPLEFTFEKGWAFPRRIYFNGDNCVMPPPDSYPWLPNASPNIATS 425          
BLAST of DC900047 vs. ExPASy Swiss-Prot
Match: COBL1_ORYSJ (COBRA-like protein 1 OS=Oryza sativa subsp. japonica GN=BC1L6 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 3.109e-14
Identity = 35/59 (59.32%), Postives = 40/59 (67.80%), Query Frame = 3
Query:   27 GXSGNVQTEMLLHKDSGIFTFREGWGFPRRILFNGDECVMPLPDDYPRLPNNAHTAASS 203
            G  GNVQ+E+L  KD   FTF +GW FPRR+ FNGD CVMP PD YP LPN +    SS
Sbjct:  369 GPDGNVQSELLFKKDPKSFTFEKGWAFPRRVYFNGDNCVMPPPDAYPWLPNASTRVMSS 427          
BLAST of DC900047 vs. ExPASy Swiss-Prot
Match: COBL7_ORYSJ (COBRA-like protein 7 OS=Oryza sativa subsp. japonica GN=BC1LP1 PE=3 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 4.060e-14
Identity = 35/58 (60.34%), Postives = 40/58 (68.97%), Query Frame = 3
Query:   36 GNVQTEMLLHKDSGIFTFREGWGFPRRILFNGDECVMPLPDDYPRLPNNAHTAASSSA 209
            GNVQTEM+L KD   FTF  GW FPRR+ F+G ECVMP PD YP LPN    +  S+A
Sbjct:  365 GNVQTEMILKKDKSDFTFSGGWAFPRRVYFDGHECVMPPPDQYPLLPNGGPDSRVSAA 422          
The following BLAST results are available for this feature:
BLAST of DC900047 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
COBL6_ARATH3.102e-2277.05COBRA-like protein 6 OS=Arabidopsis thaliana GN=CO... [more]
COBL6_ORYSJ2.543e-1662.71COBRA-like protein 6 OS=Oryza sativa subsp. japoni... [more]
COBL4_ARATH9.664e-1664.15COBRA-like protein 4 OS=Arabidopsis thaliana GN=CO... [more]
COBRA_ARATH6.264e-1564.81Protein COBRA OS=Arabidopsis thaliana GN=COB PE=2 ... [more]
COBL1_ARATH7.986e-1558.33COBRA-like protein 1 OS=Arabidopsis thaliana GN=CO... [more]
COBL5_ORYSJ1.069e-1464.15COBRA-like protein 5 OS=Oryza sativa subsp. japoni... [more]
COBL5_ORYSI1.069e-1464.15COBRA-like protein 5 OS=Oryza sativa subsp. indica... [more]
COBL2_ARATH3.109e-1458.06COBRA-like protein 2 OS=Arabidopsis thaliana GN=CO... [more]
COBL1_ORYSJ3.109e-1459.32COBRA-like protein 1 OS=Oryza sativa subsp. japoni... [more]
COBL7_ORYSJ4.060e-1460.34COBRA-like protein 7 OS=Oryza sativa subsp. japoni... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900047 VSS Citrus sinensis cDNA clone VS27Q54 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900047 ID=DC900047|Name=DC900047|organism=Citrus sinensis|type=EST|length=565bp
CTACAATGACATGTTACTCCAAGCCGGGGNAGAGTGGAAATGTACAGACT
GAGATGTTACTGCACAAAGATTCTGGAATTTTCACTTTCAGAGAAGGATG
GGGATTTCCCAGAAGAATTTTGTTTAATGGTGATGAATGTGTGATGCCTC
TTCCAGATGATTATCCAAGGCTACCCAACAATGCCCATACTGCTGCTTCA
TCAAGTGCTTGCAGAATTTTCTTGCCACTGTTACTTCTTATAGTTATGTT
GTGATTCATTTTTGGCTTATTAGGAAAATCCATCTTCTTCATGTTAGAGA
TTCAATGCGAGAGCTTCTGAATATGATTTGTTTCTGTAGAGGAATCATGT
AAATGCCATTTTCCTGAAGGGAGAATCCTTAGACATGAAAGAGCAATAGA
GGTAATTTTCTTTTTACCATTTTCGGAAATTTAGAAAAGAAGCTGTTTCA
GAAATTCAATGCTGATCAAAAGCTTGTGTTTCGCAATACAGTTTGCTTGC
CATATAAGAGAAGATTTGGAAAGAGTTAATGAAATAATTAGTGAAATATG
GCAAAACTTGCAGCC
back to top