CN184575
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CN184575 vs. ExPASy Swiss-Prot
Match: RK9_ARATH (50S ribosomal protein L9, chloroplastic OS=Arabidopsis thaliana GN=RPL9 PE=1 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 5.605e-14 Identity = 33/43 (76.74%), Postives = 42/43 (97.67%), Query Frame = -2 Query: 250 QLQRDVDKKIVVLPEIRETGEYIAQLKLHPEVTARIRLNVFAN 378 QLQ+D+DK++V LPEIRETGEYIA+LKLHP+VTAR+++NVFAN Sbjct: 155 QLQKDIDKRLVSLPEIRETGEYIAELKLHPDVTARVKINVFAN 197
BLAST of CN184575 vs. ExPASy Swiss-Prot
Match: RK9_PEA (50S ribosomal protein L9, chloroplastic OS=Pisum sativum GN=RPL9 PE=2 SV=2) HSP 1 Score: 73.9442 bits (180), Expect = 2.782e-13 Identity = 34/43 (79.07%), Postives = 41/43 (95.35%), Query Frame = -2 Query: 250 QLQRDVDKKIVVLPEIRETGEYIAQLKLHPEVTARIRLNVFAN 378 QLQR+VDK+IV LPEIRETGEYIA+LKLHP+VTA++R+NV AN Sbjct: 152 QLQREVDKRIVNLPEIRETGEYIAELKLHPDVTAKVRVNVIAN 194
BLAST of CN184575 vs. ExPASy Swiss-Prot
Match: RK9_IPOTF (50S ribosomal protein L9, chloroplastic OS=Ipomoea trifida GN=RPL9 PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 4.441e-11 Identity = 32/43 (74.42%), Postives = 38/43 (88.37%), Query Frame = -2 Query: 250 QLQRDVDKKIVVLPEIRETGEYIAQLKLHPEVTARIRLNVFAN 378 QLQR+VDK+IV LPEIRETG Y A+LKLHPEVTAR+++ V AN Sbjct: 157 QLQREVDKRIVSLPEIRETGAYTAELKLHPEVTARVQVIVSAN 199 The following BLAST results are available for this feature:
BLAST of CN184575 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CN184575 ID=CN184575; Name=CN184575; organism=Citrus sinensis; type=EST; length=379bpback to top |