CN188952

Overview
NameCN188952
Unique NameCN188952
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length784
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2695 contig Csv1_Contig2695:1..789. BLAST: Citrus Unigene V1 Contigs to Populus V2 proteins
Homology
BLAST of CN188952 vs. ExPASy Swiss-Prot
Match: SF3BB_ARATH (Uncharacterized protein At4g14342 OS=Arabidopsis thaliana GN=At4g14342 PE=3 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.319e-42
Identity = 79/87 (90.80%), Postives = 86/87 (98.85%), Query Frame = 2
Query:  323 MQASDRFNINSQLEHLQAKYVGTGHADLNRFEWAVNIQRDSYASYVGHYPILAYFSIAENESIGREHYNFMQKMLLPCGLPPEREDD 583
            MQASDRFNINSQLEHLQAKYVGTGHADL+RFEWAVNIQRDSYASY+GHYP+L+YF+IAENESIGRE YNFMQKMLLPCGLPPERE++
Sbjct:    1 MQASDRFNINSQLEHLQAKYVGTGHADLSRFEWAVNIQRDSYASYIGHYPMLSYFAIAENESIGRERYNFMQKMLLPCGLPPEREEE 87          
BLAST of CN188952 vs. ExPASy Swiss-Prot
Match: SF3BA_ARATH (Uncharacterized protein At3g23325 OS=Arabidopsis thaliana GN=At3g23325 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.319e-42
Identity = 79/87 (90.80%), Postives = 85/87 (97.70%), Query Frame = 2
Query:  323 MQASDRFNINSQLEHLQAKYVGTGHADLNRFEWAVNIQRDSYASYVGHYPILAYFSIAENESIGREHYNFMQKMLLPCGLPPEREDD 583
            MQASDRFNINSQLEHLQAKYVGTGHADL+RFEW VNIQRDSYASY+GHYP+L+YF+IAENESIGRE YNFMQKMLLPCGLPPERED+
Sbjct:    1 MQASDRFNINSQLEHLQAKYVGTGHADLSRFEWTVNIQRDSYASYIGHYPMLSYFAIAENESIGRERYNFMQKMLLPCGLPPEREDE 87          
BLAST of CN188952 vs. ExPASy Swiss-Prot
Match: SF3B5_DROME (Probable splicing factor 3B subunit 5 OS=Drosophila melanogaster GN=CG11985 PE=1 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.325e-26
Identity = 53/83 (63.86%), Postives = 66/83 (79.52%), Query Frame = 2
Query:  335 DRFNINSQLEHLQAKYVGTGHADLNRFEWAVNIQRDSYASYVGHYPILAYFSIAENESIGREHYNFMQKMLLPCGLPPEREDD 583
            +R+NI+SQLEHLQ+KY+GTGHAD  +FEW  N  RDS ASY+GHY IL YF+IAENES  R  +N M++ML PCG PPE+ +D
Sbjct:    3 ERYNIHSQLEHLQSKYIGTGHADTTKFEWLTNQHRDSLASYMGHYDILNYFAIAENESKARVRFNLMERMLQPCGPPPEKLED 85          
BLAST of CN188952 vs. ExPASy Swiss-Prot
Match: SF3B5_HUMAN (Splicing factor 3B subunit 5 OS=Homo sapiens GN=SF3B5 PE=1 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 5.566e-25
Identity = 49/84 (58.33%), Postives = 66/84 (78.57%), Query Frame = 2
Query:  332 SDRFNINSQLEHLQAKYVGTGHADLNRFEWAVNIQRDSYASYVGHYPILAYFSIAENESIGREHYNFMQKMLLPCGLPPEREDD 583
            +DR+ I+SQLEHLQ+KY+GTGHAD  ++EW VN  RDSY SY+GH+ +L YF+IAENES  R  +N M+KML PCG P ++ ++
Sbjct:    2 TDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEE 85          
BLAST of CN188952 vs. ExPASy Swiss-Prot
Match: SF3B5_BOVIN (Splicing factor 3B subunit 5 OS=Bos taurus GN=SF3B5 PE=3 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 5.566e-25
Identity = 49/84 (58.33%), Postives = 66/84 (78.57%), Query Frame = 2
Query:  332 SDRFNINSQLEHLQAKYVGTGHADLNRFEWAVNIQRDSYASYVGHYPILAYFSIAENESIGREHYNFMQKMLLPCGLPPEREDD 583
            +DR+ I+SQLEHLQ+KY+GTGHAD  ++EW VN  RDSY SY+GH+ +L YF+IAENES  R  +N M+KML PCG P ++ ++
Sbjct:    2 TDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEE 85          
BLAST of CN188952 vs. ExPASy Swiss-Prot
Match: SF3B5_MOUSE (Splicing factor 3B subunit 5 OS=Mus musculus GN=Sf3b5 PE=2 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 8.037e-24
Identity = 48/84 (57.14%), Postives = 65/84 (77.38%), Query Frame = 2
Query:  332 SDRFNINSQLEHLQAKYVGTGHADLNRFEWAVNIQRDSYASYVGHYPILAYFSIAENESIGREHYNFMQKMLLPCGLPPEREDD 583
            +DR+ I+SQLEHLQ+KY+GTGHAD  ++EW VN  RDSY SY+GH+ +L YF+IAENES  R  +N M+KML P G P ++ ++
Sbjct:    2 TDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPSGPPADKPEE 85          
BLAST of CN188952 vs. ExPASy Swiss-Prot
Match: SF3B5_DICDI (Splicing factor 3B subunit 5 OS=Dictyostelium discoideum GN=sf3b5 PE=3 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.980e-22
Identity = 47/84 (55.95%), Postives = 64/84 (76.19%), Query Frame = 2
Query:  332 SDRFNINSQLEHLQAKYVGTGHADLNRFEWAVNIQRDSYASYVGHYPILAYFSIAENESIGREHYNFMQKMLLPCGLPPEREDD 583
            S+R ++NSQLEHLQ +YVGTGHAD+++ EW  N  RDS +S++GH   L+ FSIAENES+GR  YN + KM+ PCG  P+ +D+
Sbjct:    2 SERESLNSQLEHLQMRYVGTGHADISKHEWLTNQHRDSLSSFIGHSSFLSLFSIAENESVGRVRYNTLTKMISPCGPAPKIKDN 85          
BLAST of CN188952 vs. ExPASy Swiss-Prot
Match: YHV5_SCHPO (Uncharacterized protein C211.05 OS=Schizosaccharomyces pombe GN=SPBC211.05 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.591e-14
Identity = 36/79 (45.57%), Postives = 52/79 (65.82%), Query Frame = 2
Query:  332 SDRFNINSQLEHLQAKYVGTGHADLNRFEWAVNIQRDSYASYVGHYPILAYFSIAENESIGREHYNFMQKMLLPCGLPP 568
            +DR    ++LE LQA+YVG G+A   ++EW VN  RD+ +S VGH P+LAY + A  E   +   N ++KM++PCG PP
Sbjct:    2 ADRLRSQAKLEQLQARYVGVGNAFTTKYEWMVNQHRDTLSSVVGHPPLLAYMATALGEPRVQVRKNLLEKMIMPCGPPP 80          
The following BLAST results are available for this feature:
BLAST of CN188952 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
SF3BB_ARATH1.319e-4290.80Uncharacterized protein At4g14342 OS=Arabidopsis t... [more]
SF3BA_ARATH1.319e-4290.80Uncharacterized protein At3g23325 OS=Arabidopsis t... [more]
SF3B5_DROME1.325e-2663.86Probable splicing factor 3B subunit 5 OS=Drosophil... [more]
SF3B5_HUMAN5.566e-2558.33Splicing factor 3B subunit 5 OS=Homo sapiens GN=SF... [more]
SF3B5_BOVIN5.566e-2558.33Splicing factor 3B subunit 5 OS=Bos taurus GN=SF3B... [more]
SF3B5_MOUSE8.037e-2457.14Splicing factor 3B subunit 5 OS=Mus musculus GN=Sf... [more]
SF3B5_DICDI1.980e-2255.95Splicing factor 3B subunit 5 OS=Dictyostelium disc... [more]
YHV5_SCHPO2.591e-1445.57Uncharacterized protein C211.05 OS=Schizosaccharom... [more]
back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Rind cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS06_0001B12_r Washington Navel Orange Stored Fruit Rind cDNA Library Citrus sinensis cDNA clone CS_WEc0001B12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188952 ID=CN188952|Name=CN188952|organism=Citrus sinensis|type=EST|length=784bp
GCGGAACGACACATACAGTCACACACACGCGCGAACTCGTTGCCGCCTCT
AACAAACGCGCACGCCCACGGTCTAGTTTCTCTAACCCTAAGCCAACAAA
AGCCCAAACCCACGCTGCCGCTGCCGTCACTTCCGTTCAAGGGTGCCGAC
GCTGCAGCTTCTAGCCGTTCTCGCTTTGCTTCCTCGTTCCAGCTGCTGTC
GTCTCTGCTGTTGCTGCCTCCGGCTTCGTTCGCCGTCGTCAGCCGCACAG
GCTTCAAAACCCTGCCATCGCATTCGCTCTTGCAGCCTTTTTTGTTTTCA
TTCTCAAAAAAGCACATTAAGAATGCAGGCAAGTGATAGGTTTAATATAA
ACTCCCAGCTAGAGCATCTGCAAGCCAAATACGTTGGTACTGGTCATGCT
GATTTGAACAGATTTGAGTGGGCTGTGAACATTCAGCGTGATAGCTATGC
GTCTTATGTTGGACATTATCCTATTTTGGCCTACTTTTCTATTGCCGAGA
ATGAATCTATTGGAAGGGAACACTATAACTTTATGCAGAAAATGCTTTTG
CCTTGTGGTCTGCCCCCTGAAAGAGAAGATGATTGAGAGTTTAAGATGCT
CTTTCTGAGAACGGAACATTTTGGGCTCCAGCTTTCTCCAGGCTTGAGGA
GCATTTGTGATATTGCTAGGTGTTCGCTTTCAAGTAACAATGTTCATGTG
AGACTGACAAAAACTGTGTAGTTTTGTCTACTGGGTTGAATGCTCTAGTG
TTATTGTGATCCTTGGATTTATATAAATTTTTAT
back to top