CN188946

Overview
NameCN188946
Unique NameCN188946
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length767
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2693 contig Csv1_Contig2693:1..767. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188946 vs. ExPASy Swiss-Prot
Match: IMA1B_ORYSJ (Importin subunit alpha-1b OS=Oryza sativa subsp. japonica GN=Os05g0155500 PE=1 SV=2)

HSP 1 Score: 105.916 bits (263), Expect = 2.507e-22
Identity = 48/66 (72.73%), Postives = 58/66 (87.88%), Query Frame = -1
Query:  570 GEAEKNLGNTDVNVFTQMIDDAEGLEKIESLQTHDNAEIYEKSVKLLETYWLDDEDETMPPGDASQ 767
            GEAEKNLG  DVN + QMIDDAEGLEKIE+LQ+HDN EIYEK+VK+LE+YWL++ED+ MP GD +Q
Sbjct:  449 GEAEKNLGAGDVNSYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKMLESYWLEEEDDAMPSGDNAQ 514          
BLAST of CN188946 vs. ExPASy Swiss-Prot
Match: IMA1_ARATH (Importin subunit alpha-1 OS=Arabidopsis thaliana GN=KAP1 PE=2 SV=2)

HSP 1 Score: 97.0561 bits (240), Expect = 1.165e-19
Identity = 49/70 (70.00%), Postives = 60/70 (85.71%), Query Frame = -1
Query:  570 GEAEKNLGNT-DVNVFTQMIDDAEGLEKIESLQTHDNAEIYEKSVKLLETYWLDDEDE--TMPPG-DASQ 767
            GEAEKNLG+T D+N + Q+IDDAEGLEKIE+LQ+HDN EIYEK+VK+LETYWL++ED+    PPG D SQ
Sbjct:  443 GEAEKNLGHTGDMNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDDETQQPPGVDGSQ 512          
BLAST of CN188946 vs. ExPASy Swiss-Prot
Match: IMA1A_ORYSJ (Importin subunit alpha-1a OS=Oryza sativa subsp. japonica GN=Os01g0253300 PE=1 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 9.860e-19
Identity = 42/59 (71.19%), Postives = 52/59 (88.14%), Query Frame = -1
Query:  591 GEAEKNLGNTDVNVFTQMIDDAEGLEKIESLQTHDNAEIYEKSVKLLETYWLDDEDETM 767
            GE +K L   DVNVF+QMID+AEGLEKIE+LQ+HDN EIYEK+VK+LE YW+D+ED+TM
Sbjct:  443 GETDKTLAAGDVNVFSQMIDEAEGLEKIENLQSHDNNEIYEKAVKILEAYWMDEEDDTM 501          
BLAST of CN188946 vs. ExPASy Swiss-Prot
Match: IMA_SOLLC (Importin subunit alpha OS=Solanum lycopersicum PE=2 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 2.869e-18
Identity = 42/57 (73.68%), Postives = 54/57 (94.74%), Query Frame = -1
Query:  600 GEAEKNLGNTD-VNVFTQMIDDAEGLEKIESLQTHDNAEIYEKSVKLLETYWLDDED 767
            GEA+K+LGNT+ VNV+ Q+ID+AEGLEKIE+LQ+HDN EIYEK+VK+LETYWL++ED
Sbjct:  444 GEADKDLGNTEGVNVYAQLIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEED 500          
BLAST of CN188946 vs. ExPASy Swiss-Prot
Match: IMA2_ARATH (Importin subunit alpha-2 OS=Arabidopsis thaliana GN=KAP2 PE=1 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 7.813e-16
Identity = 38/58 (65.52%), Postives = 52/58 (89.66%), Query Frame = -1
Query:  597 GEAEKNLGNT-DVNVFTQMIDDAEGLEKIESLQTHDNAEIYEKSVKLLETYWLDDEDE 767
            GEAEKNLG+T + N++ QMID+AEGLEKIE+LQ+HDN +IY+K+VK+LET+W +D +E
Sbjct:  446 GEAEKNLGHTGEDNLYAQMIDEAEGLEKIENLQSHDNNDIYDKAVKILETFWTEDNEE 503          
The following BLAST results are available for this feature:
BLAST of CN188946 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
IMA1B_ORYSJ2.507e-2272.73Importin subunit alpha-1b OS=Oryza sativa subsp. j... [more]
IMA1_ARATH1.165e-1970.00Importin subunit alpha-1 OS=Arabidopsis thaliana G... [more]
IMA1A_ORYSJ9.860e-1971.19Importin subunit alpha-1a OS=Oryza sativa subsp. j... [more]
IMA_SOLLC2.869e-1873.68Importin subunit alpha OS=Solanum lycopersicum PE=... [more]
IMA2_ARATH7.813e-1665.52Importin subunit alpha-2 OS=Arabidopsis thaliana G... [more]
back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Rind cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS06_0001B08_f Washington Navel Orange Stored Fruit Rind cDNA Library Citrus sinensis cDNA clone CS_WEc0001B08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188946 ID=CN188946|Name=CN188946|organism=Citrus sinensis|type=EST|length=767bp
TTTCTTTCATTCAATCTTAGAAGTTTTGAACAGCTTTAAACATGACATTA
GTGACTAGAAGGTATACCCATGCTATGCCTGTGCTAATAAAATGACATTT
TTGGAGTGACGGACAACAAACTCAAAATGTTCATCTTAAACAAAATGGCA
TCTGCAATGAAGCCACTACCGTGGCAAGGACAATCTTAAGACAAGCTATA
TTAGCGTATATTTGCTTATATGACACAACCCAAGCTCCATGGAGGGGAGG
CGCTTTGCTGAGAATGCAATGCTTCCTTTACTTATTGCAGCATCTGCAGA
TTACCAGTCTCACAATACATCCAATGTAGTTCTGCATCTGCAGCAGCATT
GTTCAGAATCTGAGCTAGTCCATCCTCCAAACTCACACAACACACAGAGA
TTGGACTGAACTGGACCAAACTATGACCACAACCACCACCTAACAAGAAT
CCAACACCATCATACTCCACATGGACTTCAACATGAAAGCAGCTAAAACT
CCTCTAGCTGAAATTGAAGCCACCAGATGGAGCAGGAGGATTCCCATTGC
CTCCAAATCCGAAACCAGGTTGAGAAGCATCCCCTGGTGGCATTGTCTCA
TCCTCGTCATCCAACCAATATGTTTCCAGAAGCTTTACAGACTTCTCATA
AATCTCAGCATTGTCGTGAGTTTGTAAACTCTCAATTTTCTCTAACCCCT
CAGCATCATCAATCATTTGAGTAAAGACATTTACATCTGTGTTGCCCAAA
TTCTTTTCGGCTTCTCC
back to top