CK939509
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK939509 vs. ExPASy Swiss-Prot
Match: TRXH2_TOBAC (Thioredoxin H-type 2 OS=Nicotiana tabacum PE=3 SV=1) HSP 1 Score: 93.9745 bits (232), Expect = 2.539e-19 Identity = 43/60 (71.67%), Postives = 52/60 (86.67%), Query Frame = 2 Query: 5 LAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 184 LAKK+P V FLKVDVDELKSVA +WAVEAMPTF+ KEGK+++++VGAKKDELQ + KH Sbjct: 52 LAKKMPTVTFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQTIAKH 111
BLAST of CK939509 vs. ExPASy Swiss-Prot
Match: TRXH_RICCO (Thioredoxin H-type OS=Ricinus communis PE=3 SV=1) HSP 1 Score: 93.5893 bits (231), Expect = 3.316e-19 Identity = 43/60 (71.67%), Postives = 52/60 (86.67%), Query Frame = 2 Query: 5 LAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 184 LAKKLP V FLKVDVDELK+VA EWAVE+MPTF+ KEGK+++++VGAKKDELQ + KH Sbjct: 53 LAKKLPNVTFLKVDVDELKTVAHEWAVESMPTFMFLKEGKIMDKVVGAKKDELQQTIAKH 112
BLAST of CK939509 vs. ExPASy Swiss-Prot
Match: TRXH1_ARATH (Thioredoxin H-type 1 OS=Arabidopsis thaliana GN=TRX1 PE=1 SV=1) HSP 1 Score: 93.5893 bits (231), Expect = 3.316e-19 Identity = 42/60 (70.00%), Postives = 52/60 (86.67%), Query Frame = 2 Query: 5 LAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 184 LAKKLP V+FLKVD DELKSVA +WA++AMPTF+ KEGK+L+++VGAKKDELQ + KH Sbjct: 53 LAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKH 112
BLAST of CK939509 vs. ExPASy Swiss-Prot
Match: TRXH1_TOBAC (Thioredoxin H-type 1 OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 89.3521 bits (220), Expect = 6.253e-18 Identity = 41/60 (68.33%), Postives = 52/60 (86.67%), Query Frame = 2 Query: 5 LAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 184 +AKK+P VIFLKVDVDELK+V+ EW+VEAMPTFV K+GK ++R+VGAKK+ELQ + KH Sbjct: 59 IAKKMPHVIFLKVDVDELKTVSAEWSVEAMPTFVFIKDGKEVDRVVGAKKEELQQTIVKH 118
BLAST of CK939509 vs. ExPASy Swiss-Prot
Match: TRXH_PICMA (Thioredoxin H-type OS=Picea mariana GN=SB09 PE=2 SV=1) HSP 1 Score: 80.4925 bits (197), Expect = 2.905e-15 Identity = 35/57 (61.40%), Postives = 47/57 (82.46%), Query Frame = 2 Query: 5 LAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAV 175 L+KK P + FLKVDVDEL+ VA+EW VEAMPTF+ K+GK ++++VGAKKD+L+ V Sbjct: 51 LSKKFPEIFFLKVDVDELRDVAQEWDVEAMPTFIFIKDGKAVDKVVGAKKDDLERKV 107
BLAST of CK939509 vs. ExPASy Swiss-Prot
Match: TRXH_FAGES (Thioredoxin H-type OS=Fagopyrum esculentum PE=3 SV=1) HSP 1 Score: 78.5666 bits (192), Expect = 1.104e-14 Identity = 39/60 (65.00%), Postives = 47/60 (78.33%), Query Frame = 2 Query: 5 LAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 184 LAKK P V F KVDVD+LK VAEE+ VEAMP+FV+ KEG+ +ERIVGA+KDEL + H Sbjct: 52 LAKKFPHVAFFKVDVDDLKDVAEEYKVEAMPSFVILKEGQEVERIVGARKDELLHKIAVH 111
BLAST of CK939509 vs. ExPASy Swiss-Prot
Match: TRXH_WHEAT (Thioredoxin H-type OS=Triticum aestivum PE=1 SV=3) HSP 1 Score: 78.1814 bits (191), Expect = 1.442e-14 Identity = 38/60 (63.33%), Postives = 47/60 (78.33%), Query Frame = 2 Query: 5 LAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 184 LAKK PA +FLKVDVDELK +AE+++VEAMPTF+ KEG V +R+VGA K+EL V H Sbjct: 65 LAKKFPAAVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTTKVGLH 124
BLAST of CK939509 vs. ExPASy Swiss-Prot
Match: TRXH_ORYSJ (Thioredoxin H-type OS=Oryza sativa subsp. japonica GN=TRXH PE=1 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 3.211e-14 Identity = 35/59 (59.32%), Postives = 46/59 (77.97%), Query Frame = 2 Query: 8 AKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 184 AKK P +FLKVDVDELK VAE++ VEAMPTF+ K+G +++VGA+KD+LQ + KH Sbjct: 54 AKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKH 112
BLAST of CK939509 vs. ExPASy Swiss-Prot
Match: TRXH_ORYSI (Thioredoxin H-type OS=Oryza sativa subsp. indica GN=TRXH PE=1 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 3.211e-14 Identity = 35/59 (59.32%), Postives = 46/59 (77.97%), Query Frame = 2 Query: 8 AKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 184 AKK P +FLKVDVDELK VAE++ VEAMPTF+ K+G +++VGA+KD+LQ + KH Sbjct: 54 AKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKH 112
BLAST of CK939509 vs. ExPASy Swiss-Prot
Match: TRXH5_ARATH (Thioredoxin H-type 5 OS=Arabidopsis thaliana GN=TRX5 PE=2 SV=1) HSP 1 Score: 75.8702 bits (185), Expect = 7.154e-14 Identity = 34/60 (56.67%), Postives = 47/60 (78.33%), Query Frame = 2 Query: 5 LAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 184 +AKK V+F K+DVDEL++VA+E+ VEAMPTFV KEG +++R+VGA KDE+ + KH Sbjct: 52 MAKKFTNVVFFKIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMKH 111 The following BLAST results are available for this feature:
BLAST of CK939509 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 14
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CK939509 ID=CK939509; Name=CK939509; organism=Citrus sinensis; type=EST; length=345bpback to top |