EY665737
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY665737 vs. ExPASy Swiss-Prot
Match: ABAH2_ARATH (Abscisic acid 8'-hydroxylase 2 OS=Arabidopsis thaliana GN=CYP707A2 PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 3.201e-11 Identity = 32/49 (65.31%), Postives = 40/49 (81.63%), Query Frame = -3 Query: 311 QVIQETLRTSSILSFNFKEAVQDVEFEGYIIPRGWKVLP---HIHQMEE 448 +VIQETLR +S+LSF F+EAVQDVE++GY+IP+GWKVLP IH E Sbjct: 351 RVIQETLRAASVLSFTFREAVQDVEYDGYLIPKGWKVLPLFRRIHHSSE 399
BLAST of EY665737 vs. ExPASy Swiss-Prot
Match: ABAH1_ARATH (Abscisic acid 8'-hydroxylase 1 OS=Arabidopsis thaliana GN=CYP707A1 PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 4.180e-11 Identity = 30/39 (76.92%), Postives = 37/39 (94.87%), Query Frame = -3 Query: 332 QVIQETLRTSSILSFNFKEAVQDVEFEGYIIPRGWKVLP 448 +VIQETLR +SILSF F+EAV+DVE+EGY+IP+GWKVLP Sbjct: 331 RVIQETLRVASILSFTFREAVEDVEYEGYLIPKGWKVLP 369
BLAST of EY665737 vs. ExPASy Swiss-Prot
Match: ABAH3_ARATH (Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thaliana GN=CYP707A3 PE=1 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 9.313e-11 Identity = 29/39 (74.36%), Postives = 37/39 (94.87%), Query Frame = -3 Query: 332 QVIQETLRTSSILSFNFKEAVQDVEFEGYIIPRGWKVLP 448 +VIQETLR ++ILSF F+EAV+DVE+EGY+IP+GWKVLP Sbjct: 331 RVIQETLRAATILSFTFREAVEDVEYEGYLIPKGWKVLP 369 The following BLAST results are available for this feature:
BLAST of EY665737 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY665737 ID=EY665737; Name=EY665737; organism=Citrus sinensis; type=EST; length=876bpback to top |